CENPH (NM_022909) Human Tagged ORF Clone

SKU
RG204531
CENPH (tGFP-tagged) - Human centromere protein H (CENPH)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CENPH
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204531 representing NM_022909
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCAGCCCCAGATGCAAGACGCCGACGAGCCCGCGGACTCCGGAGGGGAAGGCCGGGCAGGCG
GGCCACCGCAGGTCGCCGGCGCCCAGGCGGCGTGCAGCGAGGACCGCATGACCCTGCTCCTCAGGCTGAG
AGCACAGACAAAACAACAACTCTTAGAATATAAATCAATGGTTGATGCAAGTGAAGAAAAAACTCCAGAA
CAAATTATGCAAGAAAAGCAAATCGAAGCTAAAATTGAAGACCTGGAAAATGAAATTGAAGAGGTAAAAG
TTGCTTTTGAGATAAAAAAGCTTGCATTAGACAGGATGAGACTTTCAACTGCACTTAAAAAAAACCTGGA
GAAAATTAGCAGACAGTCTAGTGTGCTCATGGATAACATGAAACACCTATTAGAGCTAAATAAATTAATA
ATGAAATCACAGCAGGAATCTTGGGATTTAGAGGAAAAACTGCTTGATATTAGAAAGAAGAGATTGCAAT
TAAAACAAGCTTCAGAAAGTAAGCTTTTAGAAATACAGACTGAAAAGAACAAACAGAAGATTGATTTGGA
CAGTATGGAAAACTCAGAGAGGATAAAGATCATACGACAAAACCTACAGATGGAGATAAAAATTACTACT
GTTATTCAACATGTGTTCCAGAACCTTATTTTGGGGAGTAAAGTCAATTGGGCAGAGGATCCTGCCCTTA
AGGAAATTGTTCTGCAGCTTGAGAAGAATGTTGACATGATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204531 representing NM_022909
Red=Cloning site Green=Tags(s)

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE
QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI
MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT
VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022909
ORF Size 741 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022909.4
RefSeq Size 1405 bp
RefSeq ORF 744 bp
Locus ID 64946
UniProt ID Q9H3R5
Cytogenetics 5q13.2
Protein Families Druggable Genome
Summary Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CENPH (NM_022909) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204531 CENPH (Myc-DDK-tagged)-Human centromere protein H (CENPH) 10 ug
$450.00
RC204531L1 Lenti ORF clone of Human centromere protein H (CENPH), Myc-DDK-tagged 10 ug
$750.00
RC204531L2 Lenti ORF clone of Human centromere protein H (CENPH), mGFP tagged 10 ug
$750.00
RC204531L3 Lenti ORF clone of Human centromere protein H (CENPH), Myc-DDK-tagged 10 ug
$750.00
RC204531L4 Lenti ORF clone of Human centromere protein H (CENPH), mGFP tagged 10 ug
$750.00
SC112402 CENPH (untagged)-Human centromere protein H (CENPH) 10 ug
$300.00
SC322285 CENPH (untagged)-Human centromere protein H (CENPH) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.