FGF13 (NM_004114) Human Tagged ORF Clone

SKU
RG204164
FGF13 (tGFP-tagged) - Human fibroblast growth factor 13 (FGF13), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FGF13
Synonyms DEE90; FGF-13; FGF2; FHF-2; FHF2; LINC00889
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204164 representing NM_004114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCTATCGCCAGCTCGCTCATCCGTCAGAAGAGGCAAGCCCGCGAGCGCGAGAAATCCAACG
CCTGCAAGTGTGTCAGCAGCCCCAGCAAAGGCAAGACCAGCTGCGACAAAAACAAGTTAAATGTCTTTTC
CCGGGTCAAACTCTTCGGCTCCAAGAAGAGGCGCAGAAGAAGACCAGAGCCTCAGCTTAAGGGTATAGTT
ACCAAGCTATACAGCCGACAAGGCTACCACTTGCAGCTGCAGGCGGATGGAACCATTGATGGCACCAAAG
ATGAGGACAGCACTTACACTCTGTTTAACCTCATCCCTGTGGGTCTGCGAGTGGTGGCTATCCAAGGAGT
TCAAACCAAGCTGTACTTGGCAATGAACAGTGAGGGATACTTGTACACCTCGGAACTTTTCACACCTGAG
TGCAAATTCAAAGAATCAGTGTTTGAAAATTATTATGTGACATATTCATCAATGATATACCGTCAGCAGC
AGTCAGGCCGAGGGTGGTATCTGGGTCTGAACAAAGAAGGAGAGATCATGAAAGGCAACCATGTGAAGAA
GAACAAGCCTGCAGCTCATTTTCTGCCTAAACCACTGAAAGTGGCCATGTACAAGGAGCCATCACTGCAC
GATCTCACGGAGTTCTCCCGATCTGGAAGCGGGACCCCAACCAAGAGCAGAAGTGTCTCTGGCGTGCTGA
ACGGAGGCAAATCCATGAGCCACAATGAATCAACG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204164 representing NM_004114
Red=Cloning site Green=Tags(s)

MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV
TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE
CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH
DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004114
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004114.5
RefSeq Size 2673 bp
RefSeq ORF 738 bp
Locus ID 2258
UniProt ID Q92913
Cytogenetics Xq26.3-q27.1
Domains FGF
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked cognitive disability mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini. [provided by RefSeq, Nov 2008]
Write Your Own Review
You're reviewing:FGF13 (NM_004114) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204164 FGF13 (Myc-DDK-tagged)-Human fibroblast growth factor 13 (FGF13), transcript variant 1 10 ug
$300.00
RC204164L3 Lenti ORF clone of Human fibroblast growth factor 13 (FGF13), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204164L4 Lenti ORF clone of Human fibroblast growth factor 13 (FGF13), transcript variant 1, mGFP tagged 10 ug
$600.00
SC109226 FGF13 (untagged)-Human fibroblast growth factor 13 (FGF13), transcript variant 1 10 ug
$300.00
SC320392 FGF13 (untagged)-Human fibroblast growth factor 13 (FGF13), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.