CAMKK2 (NM_172226) Human Tagged ORF Clone

SKU
RG203468
CAMKK2 (tGFP-tagged) - Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$754.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CAMKK2
Synonyms CAMKK; CAMKKB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
Protein Sequence
>RG203468 representing NM_172226
Red=Cloning site Green=Tags(s)

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR
DRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL
PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT
LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT
PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM
IRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDNLQGTDPPPVGEEEVLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_172226
ORF Size 1623 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172226.2, NP_757380.1
RefSeq Size 4923 bp
RefSeq ORF 1626 bp
Locus ID 10645
UniProt ID Q96RR4
Cytogenetics 12q24.31
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways Adipocytokine signaling pathway
MW 59.6 kDa
Summary The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:CAMKK2 (NM_172226) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203468 CAMKK2 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 10 ug
$554.00
RC203468L1 Lenti-ORF clone of CAMKK2 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 10 ug
$854.00
RC203468L2 Lenti-ORF clone of CAMKK2 (mGFP-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 10 ug
$854.00
RC203468L3 Lenti-ORF clone of CAMKK2 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 10 ug
$854.00
RC203468L4 Lenti-ORF clone of CAMKK2 (mGFP-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 10 ug
$854.00
SC110186 CAMKK2 (untagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 10 ug
$505.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.