CISD1 (NM_018464) Human Tagged ORF Clone

SKU
RG203308
CISD1 (tGFP-tagged) - Human CDGSH iron sulfur domain 1 (CISD1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CISD1
Synonyms C10orf70; MDS029; mitoNEET; ZCD1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203308 representing NM_018464
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCTGACTTCCAGTTCCAGCGTACGAGTTGAATGGATCGCAGCAGTTACCATTGCTGCTGGGACAG
CTGCAATTGGTTATCTAGCTTACAAAAGATTTTATGTTAAAGATCATCGAAATAAAGCTATGATAAACCT
TCACATCCAGAAAGACAACCCCAAGATAGTACATGCTTTTGACATGGAGGATTTGGGAGATAAAGCTGTG
TACTGCCGTTGTTGGAGGTCCAAAAAGTTCCCATTCTGTGATGGGGCTCACACAAAACATAACGAAGAGA
CTGGAGACAATGTGGGCCCTCTGATCATCAAGAAAAAAGAAACT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203308 representing NM_018464
Red=Cloning site Green=Tags(s)

MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV
YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018464
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018464.5
RefSeq Size 925 bp
RefSeq ORF 327 bp
Locus ID 55847
UniProt ID Q9NZ45
Cytogenetics 10q21.1
Domains ZnF_CDGSH
Protein Families Transmembrane
Summary This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012]
Write Your Own Review
You're reviewing:CISD1 (NM_018464) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203308 CISD1 (Myc-DDK-tagged)-Human CDGSH iron sulfur domain 1 (CISD1) 10 ug
$289.00
RC203308L1 Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), Myc-DDK-tagged 10 ug
$450.00
RC203308L2 Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), mGFP tagged 10 ug
$450.00
RC203308L3 Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), Myc-DDK-tagged 10 ug
$450.00
RC203308L4 Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), mGFP tagged 10 ug
$450.00
SC113478 CISD1 (untagged)-Human CDGSH iron sulfur domain 1 (CISD1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.