N acetyl transferase 5 (NAA20) (NM_016100) Human Tagged ORF Clone

SKU
RG203305
NAA20 (tGFP-tagged) - Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol N acetyl transferase 5
Synonyms dJ1002M8.1; NAT3; NAT3P; NAT5; NAT5P
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203305 representing NM_016100
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACGCTACGGGCCTTTACCTGCGACGACCTGTTCCGCTTCAACAACATTAACTTGGATCCACTTA
CAGAAACTTATGGGATTCCTTTCTACCTACAATACCTCGCCCACTGGCCAGAGTATTTCATTGTTGCAGA
GGCACCTGGTGGAGAATTAATGGGTTATATTATGGGTAAAGCAGAAGGCTCAGTAGCTAGGGAAGAATGG
CACGGGCACGTCACAGCTCTGTCTGTTGCCCCAGAATTTCGACGCCTTGGTTTGGCTGCTAAACTTATGG
AGTTACTAGAGGAGATTTCAGAAAGAAAGGGTGGATTTTTTGTGGATCTCTTTGTAAGAGTATCTAACCA
AGTTGCAGTTAACATGTACAAGCAGTTGGGCTACAGTGTATATAGGACGGTCATAGAGTACTATTCGGCC
AGCAACGGGGAGCCTGATGAGGACGCTTATGATATGAGGAAAGCACTTTCCAGGGATACTGAGAAGAAAT
CCATCATACCATTACCTCATCCTGTGAGGCCTGAAGACATTGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203305 representing NM_016100
Red=Cloning site Green=Tags(s)

MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEW
HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSA
SNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016100
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016100.5
RefSeq Size 1360 bp
RefSeq ORF 537 bp
Locus ID 51126
UniProt ID A6NHA3
Cytogenetics 20p11.23
Domains Acetyltransf
Protein Pathways Glycerophospholipid metabolism, Limonene and pinene degradation, Phenylalanine metabolism, Tyrosine metabolism
Summary NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 2009]
Write Your Own Review
You're reviewing:N acetyl transferase 5 (NAA20) (NM_016100) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203305 NAA20 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1 10 ug
$300.00
RC203305L1 Lenti ORF clone of Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203305L2 Lenti ORF clone of Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1, mGFP tagged 10 ug
$600.00
RC203305L3 Lenti ORF clone of Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203305L4 Lenti ORF clone of Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1, mGFP tagged 10 ug
$600.00
SC114456 NAA20 (untagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.