EEF1E1 (NM_004280) Human Tagged ORF Clone

SKU
RG202732
EEF1E1 (tGFP-tagged) - Human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EEF1E1
Synonyms AIMP3; P18
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202732 representing NM_004280
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCCGCAGAGTTGTCGCTACTGGAGAAGTCCCTGGGACTGAGTAAGGGGAATAAATACAGTG
CTCAGGGCGAGCGACAGATTCCAGTTCTTCAGACAAACAATGGTCCAAGTCTAACAGGATTGACTACTAT
AGCAGCTCATCTAGTCAAGCAAGCCAACAAAGAATATTTGCTGGGGAGTACTGCAGAAGAAAAAGCAATC
GTTCAGCAGTGGTTAGAATACAGGGTCACTCAAGTAGATGGGCACTCCAGTAAAAATGACATCCACACAC
TGTTGAAGGATCTTAATTCATATCTTGAAGATAAAGTCTACCTTACAGGGTATAACTTTACATTAGCAGA
TATACTATTGTACTATGGACTTCATCGCTTTATAGTTGACCTGACAGTTCAAGAAAAGGAGAAATATCTT
AATGTGTCTCGCTGGTTTTGTCACATTCAGCATTATCCAGGCATCAGGCAACATCTGTCTAGTGTTGTCT
TCATCAAGAACAGACTATATACTAATTCCCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202732 representing NM_004280
Red=Cloning site Green=Tags(s)

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAI
VQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL
NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004280
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004280.5
RefSeq Size 1067 bp
RefSeq ORF 525 bp
Locus ID 9521
UniProt ID O43324
Cytogenetics 6p24.3
Protein Families Druggable Genome
Summary This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:EEF1E1 (NM_004280) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202732 EEF1E1 (Myc-DDK-tagged)-Human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1), transcript variant 1 10 ug
$300.00
RC202732L3 Lenti ORF clone of Human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202732L4 Lenti ORF clone of Human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1), transcript variant 1, mGFP tagged 10 ug
$600.00
SC117477 EEF1E1 (untagged)-Human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.