STARD5 (NM_181900) Human Tagged ORF Clone

SKU
RG202407
STARD5 (tGFP-tagged) - Human StAR-related lipid transfer (START) domain containing 5 (STARD5)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol STARD5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202407 representing NM_181900
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCGGCGCTGGCAGCCCAGATGAGCGAGGCTGTGGCCGAGAAGATGCTCCAGTACCGGCGGGACA
CAGCAGGCTGGAAGATTTGCCGGGAAGGCAATGGAGTTTCAGTTTCCTGGAGGCCATCTGTGGAGTTTCC
AGGGAACCTGTACCGAGGAGAAGGCATTGTATATGGGACACTAGAGGAGGTGTGGGACTGTGTGAAGCCA
GCTGTTGGAGGCCTACGAGTGAAGTGGGATGAGAATGTGACCGGTTTTGAAATTATCCAAAGCATCACTG
ACACCCTGTGTGTAAGCAGAACCTCCACTCCCTCCGCTGCCATGAAGCTCATTTCTCCCAGAGATTTTGT
GGACTTGGTGCTAGTCAAGAGATATGAGGATGGGACCATCAGTTCCAACGCCACCCATGTGGAGCATCCG
TTATGTCCCCCGAAGCCAGGTTTTGTGAGAGGATTTAACCATCCTTGTGGTTGCTTCTGTGAACCTCTTC
CAGGGGAACCCACCAAGACCAACCTGGTCACATTCTTCCATACCGACCTCAGCGGTTACCTCCCACAGAA
CGTGGTGGACTCCTTCTTCCCCCGCAGCATGACCCGGTTTTATGCCAACCTTCAGAAAGCAGTGAAGCAA
TTCCATGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202407 representing NM_181900
Red=Cloning site Green=Tags(s)

MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP
AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP
LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ
FHE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181900
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181900.3
RefSeq Size 1344 bp
RefSeq ORF 642 bp
Locus ID 80765
UniProt ID Q9NSY2
Cytogenetics 15q25.1
Summary Proteins containing a steroidogenic acute regulatory-related lipid transfer (START) domain are often involved in the trafficking of lipids and cholesterol between diverse intracellular membranes. This gene is a member of the StarD subfamily that encodes START-related lipid transfer proteins. The protein encoded by this gene is a cholesterol transporter and is also able to bind and transport other sterol-derived molecules related to the cholesterol/bile acid biosynthetic pathways such as 25-hydroxycholesterol. Its expression is upregulated during endoplasmic reticulum (ER) stress. The protein is thought to act as a cytosolic sterol transporter that moves cholesterol between intracellular membranes such as from the cytoplasm to the ER and from the ER to the Golgi apparatus. Alternative splicing of this gene produces multiple transcript variants. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:STARD5 (NM_181900) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202407 STARD5 (Myc-DDK-tagged)-Human StAR-related lipid transfer (START) domain containing 5 (STARD5) 10 ug
$300.00
RC202407L1 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 5 (STARD5), Myc-DDK-tagged 10 ug
$600.00
RC202407L2 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 5 (STARD5), mGFP tagged 10 ug
$600.00
RC202407L3 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 5 (STARD5), Myc-DDK-tagged 10 ug
$600.00
RC202407L4 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 5 (STARD5), mGFP tagged 10 ug
$600.00
SC319080 STARD5 (untagged)-Human StAR-related lipid transfer (START) domain containing 5 (STARD5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.