Cytochrome b5 (CYB5A) (NM_148923) Human Tagged ORF Clone

SKU
RG202378
CYB5A (tGFP-tagged) - Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cytochrome b5
Synonyms CYB5; MCB5; METAG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202378 representing NM_148923
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCACAACCACAGCA
AGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTTCTGGAAGAGCATCCTGGTGG
GGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACTGAGAACTTTGAGGATGTCGGGCACTCTACA
GATGCCAGGGAAATGTCCAAAACATTCATCATTGGGGAGCTCCATCCAGATGACAGACCAAAGTTAAACA
AGCCTCCGGAAACTCTTATCACTACTATTGATTCTAGTTCCAGTTGGTGGACCAACTGGGTGATCCCTGC
CATCTCTGCAGTGGCCGTCGCCTTGATGTATCGCCTATACATGGCAGAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202378 representing NM_148923
Red=Cloning site Green=Tags(s)

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST
DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_148923
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_148923.4
RefSeq Size 820 bp
RefSeq ORF 405 bp
Locus ID 1528
UniProt ID P00167
Cytogenetics 18q22.3
Protein Families Transmembrane
Summary The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:Cytochrome b5 (CYB5A) (NM_148923) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202378 CYB5A (Myc-DDK-tagged)-Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1 10 ug
$150.00
RC202378L1 Lenti ORF clone of Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202378L2 Lenti ORF clone of Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202378L3 Lenti ORF clone of Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202378L4 Lenti ORF clone of Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1, mGFP tagged 10 ug
$450.00
SC309790 CYB5A (untagged)-Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.