QIL1 (C19orf70) (NM_205767) Human Tagged ORF Clone

SKU
RG202349
C19orf70 (tGFP-tagged) - Human chromosome 19 open reading frame 70 (C19orf70)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol QIL1
Synonyms C19orf70; MIC13; P117; QIL1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202349 representing NM_205767
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGCCCGGGTGTGGTCGCTGATGAGGTTCCTCATCAAGGGAAGTGTGGCTGGGGGCGCCGTCTACC
TGGTGTACGACCAGGAGCTGCTGGGGCCCAGCGACAAGAGCCAGGCAGCCCTACAGAAGGCTGGGGAGGT
GGTCCCCCCCGCCATGTACCAGTTCAGCCAGTACGTGTGTCAGCAGACAGGCCTGCAGATACCCCAGCTC
CCAGCCCCTCCAAAGATTTACTTTCCCATCCGTGACTCCTGGAATGCAGGCATCATGACGGTGATGTCAG
CTCTGTCGGTGGCCCCCTCCAAGGCCCGCGAGTACTCCAAGGAGGGCTGGGAGTATGTGAAGGCGCGCAC
CAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202349 representing NM_205767
Red=Cloning site Green=Tags(s)

MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQL
PAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_205767
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_205767.3
RefSeq Size 943 bp
RefSeq ORF 357 bp
Locus ID 125988
UniProt ID Q5XKP0
Cytogenetics 19p13.3
Summary Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Constituent of mature MICOS complex, it is required for the formation of cristae junction (CJ) and maintenance of cristae morphology. Required for the incorporation of MICOS10/MIC10 into the MICOS complex.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:QIL1 (C19orf70) (NM_205767) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202349 C19orf70 (Myc-DDK-tagged)-Human chromosome 19 open reading frame 70 (C19orf70) 10 ug
$150.00
RC202349L3 Lenti ORF clone of Human chromosome 19 open reading frame 70 (C19orf70), Myc-DDK-tagged 10 ug
$450.00
RC202349L4 Lenti ORF clone of Human chromosome 19 open reading frame 70 (C19orf70), mGFP tagged 10 ug
$450.00
SC309824 C19orf70 (untagged)-Human chromosome 19 open reading frame 70 (C19orf70) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.