LYRM4 (NM_020408) Human Tagged ORF Clone

SKU
RG202346
LYRM4 (tGFP-tagged) - Human LYR motif containing 4 (LYRM4), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYRM4
Synonyms C6orf149; CGI-203; COXPD19; ISD11
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202346 representing NM_020408
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCCTCCAGTCGCGCACAAGTGTTAGCTCTGTACCGGGCGATGCTGAGAGAGAGCAAGCGTTTCA
GCGCCTACAATTACAGAACATATGCTGTCAGGAGGATAAGAGATGCCTTCAGAGAAAATAAAAATGTAAA
GGATCCTGTAGAAATTCAAACCCTAGTGAATAAAGCCAAGAGAGACCTTGGAGTAATTCGTCGACAGGTC
CACATTGGCCAACTGTATTCAACTGACAAGCTGATCATTGAGAATCGAGACATGCCCAGGACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202346 representing NM_020408
Red=Cloning site Green=Tags(s)

MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV
HIGQLYSTDKLIIENRDMPRT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020408
ORF Size 273 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020408.3, NP_065141.3
RefSeq Size 1499 bp
RefSeq ORF 276 bp
Locus ID 57128
UniProt ID Q9HD34
Cytogenetics 6p25.1
Summary The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:LYRM4 (NM_020408) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202346 LYRM4 (Myc-DDK-tagged)-Human LYR motif containing 4 (LYRM4), transcript variant 1 10 ug
$150.00
RC202346L1 Lenti ORF clone of Human LYR motif containing 4 (LYRM4), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202346L2 Lenti ORF clone of Human LYR motif containing 4 (LYRM4), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202346L3 Lenti ORF clone of Human LYR motif containing 4 (LYRM4), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202346L4 Lenti ORF clone of Human LYR motif containing 4 (LYRM4), transcript variant 1, mGFP tagged 10 ug
$450.00
SC113102 LYRM4 (untagged)-Human LYR motif containing 4 (LYRM4), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.