POLR1D (NM_015972) Human Tagged ORF Clone

SKU
RG201466
POLR1D (tGFP-tagged) - Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol POLR1D
Synonyms AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201466 representing NM_015972
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAGGATCAGGAGCTGGAGAGAAAAATATCTGGATTGAAGACCTCAATGGCTGAAGGCGAGAGGA
AGACAGCCCTGGAAATGGTCCAGGCAGCTGGAACAGATAGACACTGTGTGACATTTGTATTGCACGAGGA
AGACCATACCCTAGGAAATTCTCTACGTTACATGATCATGAAGAACCCGGAAGTGGAATTTTGTGGTTAC
ACTACGACCCATCCTTCAGAGAGCAAAATTAATTTACGCATTCAGACTCGAGGTACCCTTCCAGCTGTTG
AGCCATTTCAGAGAGGCCTGAATGAGCTCATGAATGTCTGCCAACATGTGCTTGACAAGTTTGAGGCCAG
CATAAAGGACTATAAGGATCAAAAAGCAAGCAGAAATGAATCCACATTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201466 representing NM_015972
Red=Cloning site Green=Tags(s)

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGY
TTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015972
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015972.4
RefSeq Size 726 bp
RefSeq ORF 402 bp
Locus ID 51082
UniProt ID P0DPB6
Cytogenetics 13q12.2
Domains RNA_pol_L
Protein Families Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Summary The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011]
Write Your Own Review
You're reviewing:POLR1D (NM_015972) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201466 POLR1D (Myc-DDK-tagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 10 ug
$150.00
RC201466L1 Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC201466L2 Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, mGFP tagged 10 ug
$450.00
RC201466L3 Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC201466L4 Lenti ORF clone of Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, mGFP tagged 10 ug
$450.00
SC108711 POLR1D (untagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 10 ug
$150.00
SC322230 POLR1D (untagged)-Human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.