ELOB (NM_007108) Human Tagged ORF Clone

SKU
RG201393
TCEB2 (tGFP-tagged) - Human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ELOB
Synonyms SIII; TCEB2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201393 representing NM_007108
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGTTCCTCATGATCCGGCGCCACAAGACCACCATCTTCACGGACGCCAAGGAGTCCAGCACGG
TGTTCGAACTGAAGCGCATCGTCGAGGGCATCCTCAAGCGGCCTCCTGACGAGCAGCGGCTGTACAAGGA
TGACCAACTCTTGGATGATGGCAAGACACTGGGCGAGTGTGGCTTCACCAGTCAAACAGCACGGCCACAG
GCCCCAGCCACAGTGGGGCTGGCCTTCCGGGCAGATGACACCTTTGAGGCCCTGTGCATCGAGCCGTTTT
CCAGCCCGCCAGAGCTGCCCGATGTGATGAAGCCCCAGGACTCGGGAAGCAGTGCCAATGAACAAGCCGT
GCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201393 representing NM_007108
Red=Cloning site Green=Tags(s)

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQ
APATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007108
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007108.4
RefSeq Size 998 bp
RefSeq ORF 357 bp
Locus ID 6923
UniProt ID Q15370
Cytogenetics 16p13.3
Domains UBQ
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis
Summary This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, Aug 2008]
Write Your Own Review
You're reviewing:ELOB (NM_007108) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201393 TCEB2 (Myc-DDK-tagged)-Human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1 10 ug
$150.00
RC201393L3 Lenti ORF clone of Human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC201393L4 Lenti ORF clone of Human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1, mGFP tagged 10 ug
$450.00
SC111036 TCEB2 (untagged)-Human transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (TCEB2), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.