HIGD2A (NM_138820) Human Tagged ORF Clone

SKU
RG201223
HIGD2A (tGFP-tagged) - Human HIG1 hypoxia inducible domain family, member 2A (HIGD2A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HIGD2A
Synonyms RCF1b
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201223 representing NM_138820
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACTCCCGGCCCTGTGATTCCGGAGGTCCCCTTTGAACCATCGAAGCCTCCAGTCATTGAGGGGC
TGAGCCCCACTGTTTACAGGAATCCAGAGAGTTTCAAGGAAAAGTTCGTTCGCAAGACCCGCGAGAACCC
GGTGGTACCCATAGGTTGCCTGGCCACGGCGGCCGCCCTCACCTACGGCCTCTACTCCTTCCACCGGGGC
AACAGCCAGCGCTCTCAGCTCATGATGCGCACCCGGATCGCCGCCCAGGGTTTCACGGTCGCAGCCATCT
TGCTGGGTCTGGCTGTCACTGCTATGAAGTCTCGACCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201223 representing NM_138820
Red=Cloning site Green=Tags(s)

MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG
NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138820
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138820.4
RefSeq Size 628 bp
RefSeq ORF 321 bp
Locus ID 192286
UniProt ID Q9BW72
Cytogenetics 5q35.2
Domains HIG_1_N
Protein Families Transmembrane
Summary The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]
Write Your Own Review
You're reviewing:HIGD2A (NM_138820) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201223 HIGD2A (Myc-DDK-tagged)-Human HIG1 hypoxia inducible domain family, member 2A (HIGD2A) 10 ug
$150.00
RC201223L3 Lenti ORF clone of Human HIG1 hypoxia inducible domain family, member 2A (HIGD2A), Myc-DDK-tagged 10 ug
$450.00
RC201223L4 Lenti ORF clone of Human HIG1 hypoxia inducible domain family, member 2A (HIGD2A), mGFP tagged 10 ug
$450.00
SC120662 HIGD2A (untagged)-Human HIG1 hypoxia inducible domain family, member 2A (HIGD2A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.