Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Tagged ORF Clone

SKU
RG201211
SUPT4H1 (tGFP-tagged) - Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Suppressor of Ty 4 homolog 1
Synonyms SPT4; SPT4H; Supt4a; SUPT4H
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201211 representing NM_003168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGGAGACGGTGCCGAAGGACCTGCGGCATCTGCGGGCCTGTTTGCTGTGTTCGCTGGTCAAGA
CTATAGACCAGTTTGAATATGATGGTTGTGACAATTGTGATGCATATCTACAAATGAAGGGTAACCGAGA
GATGGTATATGACTGCACTAGCTCTTCCTTTGATGGAATCATTGCGATGATGAGTCCAGAGGACAGCTGG
GTCTCCAAGTGGCAGCGAGTCAGTAACTTTAAGCCAGGTGTATATGCGGTGTCAGTCACTGGTCGCCTGC
CCCAAGGAATCGTGCGGGAGCTGAAAAGTCGAGGAGTGGCCTACAAATCCAGAGACACAGCTATAAAGAC
C


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201211 representing NM_003168
Red=Cloning site Green=Tags(s)

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW
VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003168
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003168.3
RefSeq Size 1499 bp
RefSeq ORF 354 bp
Locus ID 6827
UniProt ID P63272
Cytogenetics 17q22
Protein Families Transcription Factors
Summary This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]
Write Your Own Review
You're reviewing:Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201211 SUPT4H1 (Myc-DDK-tagged)-Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1) 10 ug
$150.00
RC201211L1 Lenti ORF clone of Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1), Myc-DDK-tagged 10 ug
$450.00
RC201211L2 Lenti ORF clone of Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1), mGFP tagged 10 ug
$450.00
RC201211L3 Lenti ORF clone of Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1), Myc-DDK-tagged 10 ug
$450.00
RC201211L4 Lenti ORF clone of Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1), mGFP tagged 10 ug
$450.00
SC118150 SUPT4H1 (untagged)-Human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.