C20orf20 (MRGBP) (NM_018270) Human Tagged ORF Clone

SKU
RG200114
MRGBP (tGFP-tagged) - Human chromosome 20 open reading frame 20 (C20orf20)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C20orf20
Synonyms C20orf20; Eaf7; MRG15BP; URCC4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200114 representing NM_018270
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGAGGCCGAGGTGGGCGGCGGGGGCGCCGCAGGCGACAAGGGCCCGGGGGAGGCGGCCACCAGCC
CGGCGGAGGAGACAGTGGTGTGGAGCCCCGAGGTGGAGGTGTGCCTCTTCCACGCCATGCTGGGCCACAA
GCCCGTCGGTGTGAACCGACACTTCCACATGATTTGTATTCGGGACAAGTTCAGCCAGAACATCGGGCGG
CAGGTCCCATCCAAGGTCATCTGGGACCATCTGAGCACCATGTACGACATGCAGGCGCTGCATGAGTCTG
AGATTCTTCCATTCCCGAATCCAGAGAGGAACTTCGTCCTTCCAGAAGAGATCATTCAGGAGGTCCGAGA
AGGAAAAGTGATGATAGAAGAGGAGATGAAAGAGGAGATGAAGGAAGACGTGGACCCCCACAATGGGGCT
GACGATGTTTTTTCATCTTCAGGGAGTTTGGGGAAAGCATCAGAAAAATCCAGCAAAGACAAAGAGAAGA
ACTCCTCAGACTTGGGGTGCAAAGAAGGCGCAGACAAGCGGAAGCGCAGCCGGGTCACCGACAAAGTCCT
GACCGCAAACAGCAACCCTTCCAGTCCCAGTGCTGCCAAGCGGCGCCGCACG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200114 representing NM_018270
Red=Cloning site Green=Tags(s)

MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGR
QVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGA
DDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018270
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018270.6
RefSeq Size 1685 bp
RefSeq ORF 615 bp
Locus ID 55257
UniProt ID Q9NV56
Cytogenetics 20q13.33
Protein Families Transcription Factors
Summary Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C20orf20 (MRGBP) (NM_018270) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200114 MRGBP (Myc-DDK-tagged)-Human chromosome 20 open reading frame 20 (C20orf20) 10 ug
$300.00
RC200114L1 Lenti ORF clone of Human chromosome 20 open reading frame 20 (C20orf20), Myc-DDK-tagged 10 ug
$600.00
RC200114L2 Lenti ORF clone of Human chromosome 20 open reading frame 20 (C20orf20), mGFP tagged 10 ug
$600.00
RC200114L3 Lenti ORF clone of Human chromosome 20 open reading frame 20 (C20orf20), Myc-DDK-tagged 10 ug
$600.00
RC200114L4 Lenti ORF clone of Human chromosome 20 open reading frame 20 (C20orf20), mGFP tagged 10 ug
$600.00
SC113588 MRGBP (untagged)-Human chromosome 20 open reading frame 20 (C20orf20) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.