FRA1 (FOSL1) (NM_001300856) Human Tagged ORF Clone

SKU
RC236553
FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FRA1
Synonyms FRA; fra-1; FRA1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC236553 representing NM_001300856
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGC
CCCCGGCCGCAGCGCAGGCAGCCCAGCAGATCAGCCCGGAGGAAGAGGAGCGCCGCCGAGTAAGGCGCGA
GCGGAACAAGCTGGCTGCGGCCAAGTGCAGGAACCGGAGGAAGGAACTGACCGACTTCCTGCAGGCGGAG
ACTGACAAACTGGAAGATGAGAAATCTGGGCTGCAGCGAGAGATTGAGGAGCTGCAGAAGCAGAAGGAGC
GCCTAGAGCTGGTGCTGGAAGCCCACCGACCCATCTGCAAAATCCCGGAAGGAGCCAAGGAGGGGGACAC
AGGCAGTACCAGTGGCACCAGCAGCCCACCAGCCCCCTGCCGCCCTGTACCTTGTATCTCCCTTTCCCCA
GGGCCTGTGCTTGAACCTGAGGCACTGCACACCCCCACACTCATGACCACACCCTCCCTAACTCCTTTCA
CCCCCAGCCTGGTCTTCACCTACCCCAGCACTCCTGAGCCTTGTGCCTCAGCTCATCGCAAGAGTAGCAG
CAGCAGCGGAGACCCATCCTCTGACCCCCTTGGCTCTCCAACCCTCCTCGCTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC236553 representing NM_001300856
Red=Cloning site Green=Tags(s)

MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAE
TDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSP
GPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001300856
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001300856.2
RefSeq Size 1561 bp
RefSeq ORF 618 bp
Locus ID 8061
UniProt ID P15407
Cytogenetics 11q13.1
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Wnt signaling pathway
MW 22.4 kDa
Summary The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:FRA1 (FOSL1) (NM_001300856) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG236553 FOSL1 (tGFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4 10 ug
$530.00
SC334447 FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.