SENP7 (NM_001282804) Human Tagged ORF Clone

SKU
RC236237
SENP7 (myc-DDK-tagged) - Human SUMO1/sentrin specific peptidase 7 (SENP7), transcript variant 6
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SENP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC236237 representing NM_001282804
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTAAATGCAAAACCAGAGGATGTCCATGTTCAATCACCACTGTCCAAATTCAGAAGCTCAGAACGCT
GGACTCTCCCTTTGCAGTGGGAAAGAAGCCTAAGGAATAAAGTCATCTCTCTAGACCATAAAAATAAAAA
ACATATCCGAGGGTGTCCTGTTACTTCCAAGTCATCACCAGAAAGGCAACTCAAAGTTATGTTGACGAAT
GTCCTATGGACGGATTTAGGACGAAAATTCAGAAAGACCCTACCTAGAAACGATGCTAATTTATGTGATG
CCAACAAGGTGCAATCAGACTCATTGCCTTCGACATCTGTTGACAGCCTAGAGACATGTCAAAAATTAGA
ACCTCTTCGCCAAAGCCTTAATTTATCTGAAAGGGGCTCACAACGAAGTAAGACAGTAGATGACAATTCT
GCAAAGCAGACTGCGCACAATAAAGAAAAACGAAGAAAGGATGATGGCATTTCTCTTTTAATATCTGATA
CTCAGCCTGAAGGTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC236237 representing NM_001282804
Red=Cloning site Green=Tags(s)

MLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSKSSPERQLKVMLTN
VLWTDLGRKFRKTLPRNDANLCDANKVQSDSLPSTSVDSLETCQKLEPLRQSLNLSERGSQRSKTVDDNS
AKQTAHNKEKRRKDDGISLLISDTQPEGL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001282804
ORF Size 507 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001282804.1, NP_001269733.1
RefSeq Size 827 bp
RefSeq ORF 510 bp
Locus ID 57337
UniProt ID Q9BQF6
Cytogenetics 3q12.3
Protein Families Druggable Genome, Protease
MW 19.7 kDa
Summary The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for many cellular processes. SUMO-specific proteases, such as SENP7, process SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also display isopeptidase activity for deconjugation of SUMO-conjugated substrates (Lima and Reverter, 2008 [PubMed 18799455]).[supplied by OMIM, Jun 2009]
Write Your Own Review
You're reviewing:SENP7 (NM_001282804) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG236237 SENP7 (tGFP-tagged) - Human SUMO1/sentrin specific peptidase 7 (SENP7), transcript variant 6 10 ug
$530.00
SC334131 SENP7 (untagged) - Human SUMO1/sentrin specific peptidase 7 (SENP7), transcript variant 6 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.