MED8 (NM_001001653) Human Tagged ORF Clone

SKU
RC233374
MED8 (Myc-DDK tagged) - Homo sapiens mediator complex subunit 8 (MED8), transcript variant 4
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MED8
Synonyms ARC32
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC233374 representing NM_001001653
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCAGACTGAAGGACGGGTGCCTGTTTTCAGCCATGAGGTAGTCCCTGACCATCTGAGAACCAAGC
CTGACCCTGAAGTGGAAGAACAGGAGAAGCAACTGACGACAGATGCTGCCCGCATTGGTGCAGATGCAGC
CCAGAAGCAGATCCAGAGCTTGAATAAAATGTGTTCAAACCTTCTGGAGAAAATCAGCAAAGAGGAGCGA
GAATCAGAGAGTGGAGGTCTCCGGCCGAACAAGCAGACCTTTAACCCTACAGACACTAATGCCTTGGTGG
CAGCTGTTGCCTTTGGGAAAGGACTATCTAATTGGAGACCTTCAGGCAGCAGTGGTCCTGGCCAGGCAGG
CCAGCCAGGAGCTGGGACGATCCTTGCAGGAACCTCAGGATTACAGCAGGTGCAGATGGCAGGAGCTCCA
AGCCAGCAGCAGCCAATGCTCAGTGGGGTACAAATGGCTCAGGCAGGTCAACCAGGGAAAATGCCAAGTG
GAATAAAAACCAACATCAAGTCGGCTTCCATGCATCCCTACCAGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC233374 representing NM_001001653
Red=Cloning site Green=Tags(s)

MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEER
ESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAP
SQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001001653
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001653.3
RefSeq Size 2032 bp
RefSeq ORF 540 bp
Locus ID 112950
UniProt ID Q96G25
Cytogenetics 1p34.2
Protein Families Druggable Genome, Transcription Factors
MW 19.5 kDa
Summary This gene encodes a protein component of the mediator complex, which aids in transcriptional activation through interaction with RNA polymerase II and gene-specific transcription factors. The encoded protein may also function in ubiquitin ligation and protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]
Write Your Own Review
You're reviewing:MED8 (NM_001001653) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG233374 MED8 (tGFP-tagged) - Homo sapiens mediator complex subunit 8 (MED8), transcript variant 4 10 ug
$530.00
SC331121 MED8 (untagged) - Homo sapiens mediator complex subunit 8 (MED8), transcript variant 4 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.