Caspase 12 (CASP12) (NM_001191016) Human Tagged ORF Clone

SKU
RC231175
CASP12 (Myc-DDK-tagged)-Human caspase 12 (gene/pseudogene) (CASP12), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Caspase 12
Synonyms CASP-12; CASP12P1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231175 representing NM_001191016
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGATGAGAAACCATCCAACGGTGTTCTGGTCCACATGGTGAAGTTGCTGATCAAGACCTTTCTAG
ATGGCATTTTTGATGATTTGATGGAAAATAATGTATTAAATACAGATGAGATACACCTTATAGGAAAATG
TCTAAAGTTTGTGGTGAGCAATGCTGAAAACCTGGTTGATGATATCACTGAGACAGCTCAAACTGCAGGC
AAAATATTTAGGGAACACCTGTGGAATTCCAAAAAACAGCTGAGTTCAGATATATCCAGTGATGGAGAAA
GAGAGGCGAACATGCCTGGCCTCAACATCCGCAACAAAGAATTCAACTATCTTCATAATCGAAATGGTTC
TGAACTTGACCTTTTGGGGATGCGAGATCTACTTGAAAACCTTGGATACTCAGTGGTTATAAAAGAGAAT
CTCACAGCTCAGGAAATGGAAACAGCACTAAGGCAGTTTGCTGCTCACCCAGAGCACCAGTCCTCAGACA
GCACATTCCTGGTGTTTATGTCACATAGCATCCTGAATGGAATCTGTGGGACCAAGCACTGGGATCAAGA
GCCAGATGTTCTTCACGATGACACCATCTTTGAAATTTTCAACAACCGTAACTGCCAGAGTCTGAAAGAC
AAACCCAAGGTCATCATCATGCAAGCCTGCCGAGGCAATGGTGCTGGGATTGTTTGGTTCACCACTGACA
GTGGAAAAGCCGGTGCAGATACTCATGGTCGGCTCTTGCAAGGTAACATCTGTAATGATGCTGTTACAAA
GGCTCATGTGGAAAAGGACTTCATTGCTTTCAAATCTTCCACACCACATAATGTTTCTTGGAGACATGAA
ACAAATGGCTCTGTCTTCATTTCCCAAATTATCTACTACTTCAGAGAGTATTCTTGGAGTCATCATCTAG
AGGAAATTTTTCAAAAGGTTCAACATTCATTTGAGACCCCAAATATACTGACCCAGCTGCCCACCATTGA
AAGACTATCCATGACACGATATTTCTATCTCTTTCCTGGGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231175 representing NM_001191016
Red=Cloning site Green=Tags(s)

MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVDDITETAQTAG
KIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGYSVVIKEN
LTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICGTKHWDQEPDVLHDDTIFEIFNNRNCQSLKD
KPKVIIMQACRGNGAGIVWFTTDSGKAGADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHE
TNGSVFISQIIYYFREYSWSHHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001191016
ORF Size 1023 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001191016.1, NP_001177945.1
RefSeq ORF 1026 bp
Locus ID 100506742
UniProt ID Q6UXS9
Cytogenetics 11q22.3
MW 39.4 kDa
Summary Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. Several alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:Caspase 12 (CASP12) (NM_001191016) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC231175L1 Lenti ORF clone of Human caspase 12 (gene/pseudogene) (CASP12), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC231175L2 Lenti ORF clone of Human caspase 12 (gene/pseudogene) (CASP12), transcript variant 1, mGFP tagged 10 ug
$986.00
RC231175L3 Lenti ORF clone of Human caspase 12 (gene/pseudogene) (CASP12), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC231175L4 Lenti ORF clone of Human caspase 12 (gene/pseudogene) (CASP12), transcript variant 1, mGFP tagged 10 ug
$986.00
RG231175 CASP12 (tGFP-tagged) - Human caspase 12 (gene/pseudogene) (CASP12), transcript variant 1 10 ug
$886.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.