NDUFA11 (NM_001193375) Human Tagged ORF Clone

SKU
RC231076
NDUFA11 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa (NDUFA11), nuclear gene encoding mitochondrial protein, transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NDUFA11
Synonyms B14.7; CI-B14.7; MC1DN14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231076 representing NM_001193375
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCGAAGGTTTTTCGTCAGTACTGGGATATCCCCGATGGCACCGATTGCCACCGCAAAGCCTACA
GCACCACCAGTATTGCCAGCGTCGCTGGCCTGACCGCCGCTGCCTACAGAGTCACACTCAATCCTCCGGG
CACCTTCCTTGAAGGAGTGGCTAAGGTTGGACAATACACGTTCACTGCAGCTGCTGTCGGGGCCGTGTTT
GGCCTCACCACCTGCATCAGCGCCCATGTCCGCGAGAAGCCCGACGACCCCCTGAACTACTTCCTCGGTG
GCTGCGCCGGAGGCCTGACTCTGGGAGCACGCAAGACAGGATCTCACTGTGTTGTGCAGGCTGGTCTCAA
ACTCCTGGCCTCGAGCAGTCCTCACACCTCAGCCTCCCAGAGTGCTGGGATTATAGGCATGAGCCACTGT
GTACAGAGATTCTGGGTCCCTTCTTCCAGCGCCTGCCTCGAAGTCCTCTCTGGAGAGAGCACAGATGTCC
ACGCGTGTTCCAGCACAAGGGGGGCATGCAACAGCTCAGGGTCACGTCCACTTCCGGAGCTGGGTGCCCG
GGCCTCGGGCTCCCTGAGAAAGGGCGGACACACCCACCCCGCACCCAGAGGGGCAGGGGCCCTGACACCT
GTCCAAGCCCTAATAGAGTCATTGTTAAACACTCTGGGTTCGAACCCCAGAACT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231076 representing NM_001193375
Red=Cloning site Green=Tags(s)

MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVF
GLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARKTGSHCVVQAGLKLLASSSPHTSASQSAGIIGMSHC
VQRFWVPSSSACLEVLSGESTDVHACSSTRGACNSSGSRPLPELGARASGSLRKGGHTHPAPRGAGALTP
VQALIESLLNTLGSNPRT

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_001193375
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001193375.2
RefSeq ORF 687 bp
Locus ID 126328
UniProt ID Q86Y39
Cytogenetics 19p13.3
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Oxidative phosphorylation
MW 23.9 kDa
Summary This gene encodes a subunit of the membrane-bound mitochondrial complex I. Complex I is composed of numerous subunits and functions as the NADH-ubiquinol reductase of the mitochondrial electron transport chain. Mutations in this gene are associated with severe mitochondrial complex I deficiency. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:NDUFA11 (NM_001193375) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC231076L3 Lenti-ORF clone of NDUFA11 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa (NDUFA11), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$630.00
RC231076L4 Lenti-ORF clone of NDUFA11 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa (NDUFA11), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$630.00
RG231076 NDUFA11 (tGFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa (NDUFA11), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$530.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.