HLA-DQB2 (NM_001198858) Human Tagged ORF Clone

SKU
RC231073
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HLA-DQB2
Synonyms DQB2; HLA-DQB1; HLA-DXB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC231073 representing NM_001198858
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGCAGATCCCTGGAGGCTTTTGGGCAGCAGCTGTGACCGTGATGCTGGTGATGCTGAGCACCC
CAGTGGCTGAGGCCAGAGACTTTCCCAAGGATTTCTTGGTCCAGTTTAAGGGCATGTGCTACTTCACCAA
CGGGACAGAGCGCGTGCGCGGTGTGGCCAGATACATCTATAACCGCGAGGAGTACGGGCGCTTCGACAGC
GACGTTGGGGAGTTCCAGGCGGTGACCGAGCTGGGGCGGAGCATCGAGGACTGGAACAACTATAAGGACT
TCTTGGAGCAGGAGCGGGCCGCGGTGGACAAGGTGTGCAGACACAACTACGAGGCGGAGCTGCGCACGAC
CTTGCAGCGGCAAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCACCACAAC
CTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGAATGACCAGG
AGGAGACAGCCGGTGTTGTGTCCACCTCCCTCATTAGGAATGGTGACTGGACCTTCCAGATTCTGGTGAT
GCTGGAAATAACTCCCCAGCGTGGAGACATCTACACCTGCCAAGTGGAGCACCCCAGCCTCCAGAGCCCC
ATCACCGTGGAGTGGCGACCTCGAGGGCCTCCACCAGCAGGACTCCTGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231073 representing NM_001198858
Red=Cloning site Green=Tags(s)

MALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDS
DVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHN
LLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSP
ITVEWRPRGPPPAGLLH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001198858
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001198858.2
RefSeq ORF 684 bp
Locus ID 3120
UniProt ID P05538
Cytogenetics 6p21.32
MW 26.5 kDa
Summary HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:HLA-DQB2 (NM_001198858) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC231073L3 Lenti ORF clone of Human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2), Myc-DDK-tagged 10 ug
$600.00
RC231073L4 Lenti ORF clone of Human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2), mGFP tagged 10 ug
$600.00
RG231073 HLA (tGFP-tagged) - Human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2) 10 ug
$500.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.