BCL7B (NM_001197244) Human Tagged ORF Clone

SKU
RC230990
BCL7B (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BCL7B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC230990 representing NM_001197244
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGCCGGTCGGTCCGGGCGGAGACCCGCAGCCGGGCCAAGGACGACATCAAGAAGGTGATGGCGG
CCATCGAGAAAGTGCGGAAATGGGAGAAGAAGTGGGTGACTGTGGGTGACACGTCCCTGAGGATATTTAA
GTGGGTTCCTGTGACAGACAGCAAGGAGAAAGAAAAGTCAAAATCGAACAGTTCAGCAGCCCGAGAACCT
AATGGCTTTCCTTCTGATGCCTCAGCCAATTCCTCTCTCCTTCTTGAATTCCAGGAGCCCTCCCTGCCCT
CCTCGGAAGTTGCTGATGAACCTCCTACCCTCACCAAGGAAGAACCAGTTCCACTAGAGACACAGGTCGT
TGAGGAAGAGGAAGACTCAGGTGCCCCGCCCCTGAAGCGCTTCTGTGTGGACCAACCCACAGTGCCGCAG
ACGGCGTCAGAAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC230990 representing NM_001197244
Red=Cloning site Green=Tags(s)

MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP
NGFPSDASANSSLLLEFQEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQ
TASES

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001197244
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001197244.2
RefSeq ORF 438 bp
Locus ID 9275
UniProt ID Q9BQE9
Cytogenetics 7q11.23
MW 16.5 kDa
Summary This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:BCL7B (NM_001197244) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC230990L3 Lenti ORF clone of Human B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC230990L4 Lenti ORF clone of Human B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2, mGFP tagged 10 ug
$450.00
RG230990 BCL7B (tGFP-tagged) - Human B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2 10 ug
$350.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.