KF1 (RNF103) (NM_001198952) Human Tagged ORF Clone

SKU
RC230957
RNF103 (Myc-DDK-tagged)-Human ring finger protein 103 (RNF103), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KF1
Synonyms HKF-1; KF-1; KF1; ZFP-103; ZFP103
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC230957 representing NM_001198952
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCTGAAGCTTTTTTTCTTGCTCCTCTATTTCCTGGTCCTGTTCGTCCTGGCCAGGTTTTTTGAGG
CCATTGTGTGGTATGAAACTGGCATCTTTGCCACCCAGCTGGTGGATCCGGTGGCGCTGAGCTTCAAGAA
GCTGAAGACCATTTTGGAGTGCCGGGGGTTGGGCTACTCAGGGTTGCCCGAGAAGAAGGATGTCCGGGAG
CTGGTGGAAAAGTCAGGTGACTTGATGGAGGGTGAGCTCTATTCTGCTCTCAAGGAAGAAGAAGCATCCG
AATCGGTTTCTAGTACCAATTTCAGTGGTGAAATGCACTTCTATGAGCTTGTGGAAGACACAAAAGATGG
CATCTGGCTGGTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC230957 representing NM_001198952
Red=Cloning site Green=Tags(s)

MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYSGLPEKKDVRE
LVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001198952
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001198952.2
RefSeq ORF 369 bp
Locus ID 7844
UniProt ID O00237
Cytogenetics 2p11.2
Protein Families Druggable Genome, Transcription Factors, Transmembrane
MW 14.5 kDa
Summary The protein encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants. The protein is a ubiquitin ligase that functions in the endoplasmic reticulum-associated degradation pathway. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream CHMP3 (charged multivesicular body protein 3) gene. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:KF1 (RNF103) (NM_001198952) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC230957L3 Lenti-ORF clone of RNF103 (Myc-DDK-tagged)-Human ring finger protein 103 (RNF103), transcript variant 3 10 ug
$465.00
RC230957L4 Lenti-ORF clone of RNF103 (mGFP-tagged)-Human ring finger protein 103 (RNF103), transcript variant 3 10 ug
$465.00
RG230957 RNF103 (tGFP-tagged) - Human ring finger protein 103 (RNF103), transcript variant 3 10 ug
$365.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.