KF1 (RNF103) (NM_001198952) Human Tagged ORF Clone
SKU
RC230957
RNF103 (Myc-DDK-tagged)-Human ring finger protein 103 (RNF103), transcript variant 3
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | KF1 |
Synonyms | HKF-1; KF-1; KF1; ZFP-103; ZFP103 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC230957 representing NM_001198952
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGGCTGAAGCTTTTTTTCTTGCTCCTCTATTTCCTGGTCCTGTTCGTCCTGGCCAGGTTTTTTGAGG CCATTGTGTGGTATGAAACTGGCATCTTTGCCACCCAGCTGGTGGATCCGGTGGCGCTGAGCTTCAAGAA GCTGAAGACCATTTTGGAGTGCCGGGGGTTGGGCTACTCAGGGTTGCCCGAGAAGAAGGATGTCCGGGAG CTGGTGGAAAAGTCAGGTGACTTGATGGAGGGTGAGCTCTATTCTGCTCTCAAGGAAGAAGAAGCATCCG AATCGGTTTCTAGTACCAATTTCAGTGGTGAAATGCACTTCTATGAGCTTGTGGAAGACACAAAAGATGG CATCTGGCTGGTTCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC230957 representing NM_001198952
Red=Cloning site Green=Tags(s) MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYSGLPEKKDVRE LVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQ myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001198952 |
ORF Size | 366 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001198952.2 |
RefSeq ORF | 369 bp |
Locus ID | 7844 |
UniProt ID | O00237 |
Cytogenetics | 2p11.2 |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
MW | 14.5 kDa |
Summary | The protein encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants. The protein is a ubiquitin ligase that functions in the endoplasmic reticulum-associated degradation pathway. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream CHMP3 (charged multivesicular body protein 3) gene. [provided by RefSeq, Oct 2011] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC230957L3 | Lenti-ORF clone of RNF103 (Myc-DDK-tagged)-Human ring finger protein 103 (RNF103), transcript variant 3 | 10 ug |
$465.00
|
|
RC230957L4 | Lenti-ORF clone of RNF103 (mGFP-tagged)-Human ring finger protein 103 (RNF103), transcript variant 3 | 10 ug |
$465.00
|
|
RG230957 | RNF103 (tGFP-tagged) - Human ring finger protein 103 (RNF103), transcript variant 3 | 10 ug |
$365.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.