CD244 (NM_001166664) Human Tagged ORF Clone

SKU
RC229806
CD244 (Myc-DDK-tagged)-Human CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD244
Synonyms 2B4; NAIL; NKR2B4; Nmrk; SLAMF4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC229806 representing NM_001166664
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGGCAAGTGGTCACCCTCATACTCCTCCTGCTCCTCAAGGTGTATCAGGGCAAAGGATGCCAGG
GATCAGCTGACCATGTGGTTAGCATCTCGGGAGTGCCTCTTCAGTTACAACCAAACAGCATACAGACGAA
GGTTGACAGCATTGCATGGAAGAAGTTGCTGCCCTCACAAAATGGATTTCATCACATATTGAAGTGGGAG
AATGGCTCTTTGCCTTCCAATACTTCCAATGATAGATTCAGTTTTATAGTCAAGAACTTGAGTCTTCTCA
TCAAGGCAGCTCAGCAGCAGGACAGTGGCCTCTACTGCCTGGAGGTCACCAGTATATCTGGAAAAGTTCA
GACAGCCACGTTCCAGGTTTTTGTATTTGAATTCAGATTTTGGCCGTTTTTGGTGATCATCGTGATTCTA
AGCGCACTGTTCCTTGGCACCCTTGCCTGCTTCTGTGTGTGGAGGAGAAAGAGGAAGGAGAAGCAGTCAG
AGACCAGTCCCAAGGAATTTTTGACAATTTACGAAGATGTCAAGGATCTGAAAACCAGGAGAAATCACGA
GCAGGAGCAGACTTTTCCTGGAGGGGGGAGCACCATCTACTCTATGATCCAGTCCCAGTCTTCTGCTCCC
ACGTCACAAGAACCTGCATATACATTATATTCATTAATTCAGCCTTCCAGGAAGTCTGGATCCAGGAAGA
GGAACCACAGCCCTTCCTTCAATAGCACTATCTATGAAGTGATTGGAAAGAGTCAACCTAAAGCCCAGAA
CCCTGCTCGATTGAGCCGCAAAGAGCTGGAGAACTTTGATGTTTATTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC229806 representing NM_001166664
Red=Cloning site Green=Tags(s)

MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE
NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFEFRFWPFLVIIVIL
SALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAP
TSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001166664
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001166664.2
RefSeq ORF 822 bp
Locus ID 51744
UniProt ID Q9BZW8
Cytogenetics 1q23.3
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity
MW 31.2 kDa
Summary This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:CD244 (NM_001166664) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC229806L3 Lenti ORF clone of Human CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC229806L4 Lenti ORF clone of Human CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, mGFP tagged 10 ug
$600.00
RG229806 CD244 (tGFP-tagged) - Human CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3 10 ug
$500.00
SC328444 CD244 (untagged)-Human CD244 molecule natural killer cell receptor 2B4 (CD244) transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.