CD84 (NM_001184881) Human Tagged ORF Clone

SKU
RC229804
CD84 (Myc-DDK-tagged)-Human CD84 molecule (CD84), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD84
Synonyms hCD84; LY9B; mCD84; SLAMF5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC229804 representing NM_001184881
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCAGCACCACCTATGGATCTTGCTCCTTTGCCTGCAAACCTGGCCGGAAGCAGCTGGAAAAGACT
CAGAAATCTTCACAGTGAATGGGATTCTGGGAGAGTCAGTCACTTTCCCTGTAAATATCCAAGAACCACG
GCAAGTTAAAATCATTGCTTGGACTTCTAAAACATCTGTTGCTTATGTAACACCAGGAGACTCAGAAACA
GCACCCGTAGTTACTGTGACCCACAGAAATTATTATGAACGGATACATGCCTTAGGTCCGAACTACAATC
TGGTCATTAGCGATCTGAGGATGGAAGACGCAGGAGACTACAAAGCAGACATAAATACACAGGCTGATCC
CTACACCACCACCAAGCGCTACAACCTGCAAATCTATCGTCGGCTTGGGAAACCAAAAATTACACAGAGT
TTAATGGCATCTGTGAACAGCACCTGTAATGTCACACTGACATGCTCTGTAGAGAAAGAAGAAAAGAATG
TGACATACAATTGGAGTCCCCTGGGAGAAGAGGGTAATGTCCTTCAAATCTTCCAGACTCCTGAGGACCA
AGAGCTGACTTACACGTGTACAGCCCAGAACCCTGTCAGCAACAATTCTGACTCCATCTCTGCCCGGCAG
CTCTGTGCAGACATCGCAATGGGCTTCCGTACTCACCACACCGGGTTGCTGAGCGTGCTGGCTATGTTCT
TTCTGCTTGTTCTCATTCTGTCTTCAGTGTTTTTGTTCCGTTTGTTCAAGAGAAGACAAGGTGCTTCCCT
CCAAGGAAGAGCCAGTGAACACAGTTTATTCCGAAGTGCAGTTTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC229804 representing NM_001184881
Red=Cloning site Green=Tags(s)

MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET
APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS
LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ
LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGASLQGRASEHSLFRSAVC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001184881
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001184881.2
RefSeq ORF 819 bp
Locus ID 8832
UniProt ID Q9UIB8
Cytogenetics 1q23.3
Protein Families Druggable Genome, Transmembrane
MW 31 kDa
Summary This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:CD84 (NM_001184881) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC229804L3 Lenti ORF clone of Human CD84 molecule (CD84), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC229804L4 Lenti ORF clone of Human CD84 molecule (CD84), transcript variant 3, mGFP tagged 10 ug
$600.00
RG229804 CD84 (tGFP-tagged) - Human CD84 molecule (CD84), transcript variant 3 10 ug
$500.00
SC328442 CD84 (untagged)-Human CD84 molecule (CD84) transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.