BEAN1 (NM_001178020) Human Tagged ORF Clone

SKU
RC229781
BEAN1 (Myc-DDK-tagged)-Human brain expressed, associated with NEDD4, 1 (BEAN1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BEAN1
Synonyms BEAN; SCA31
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC229781 representing NM_001178020
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTCAAACGTCCCTGCCCCTTAGCACGATACAACCGCACCAGCTACTTCTACCCCACATTCTCAG
AGAGCTCGGAGCACAGCCATCTGCTCGTGTCCCCCGTGCTGGTGGCGAGTGCCGTCATAGGTGTGGTCAT
CATCCTCTCCTGCATCACCATCATTGTGGGCAGCATCCGCAGGGACAGGCAGGCCCGGCTTCAGCGGCAC
CGCCACCGCCACCACCGCCACCACCACCACCATCATCACCACCGCCGGCGTCGACACCGAGAGTACGAGC
ACGGCTACGTGTCGGACGAGCACACATACAGCCGCTCAAGCCGCAGGATGCGCTATGCCTGCAGCTCCTC
AGAGGACTGGCCCCCACCCTTGGACATCAGCTCTGACGGGGACGTGGATGCCACGGTGCTCAGGGAGCTG
TACCCAGATTCTCCACCAGGCTACGAGGAGTGTGTGGGGCCAGGGGCCACTCAGCTGTATGTCCCCACGG
ACGCACCACCACCCTACTCGCTGACTGATTCCTGCCCCACGCTGGATGGCACCTCCGACTCAGGCAGCGG
CCACAGCCCTGGCCGACACCAGCAGGAGCAGAGGACCCCGGCCCAAGGTGGCCTTCACACGGTCTCCATG
GACACCCTTCCCCCCTACGAGGCTGTGTGCGGGGCTGGCCCCCCATCAGGCCTGCTGCCACTGCCGGGCC
CAGACCCAGGGCCAAGGGGCTCCCAGGGCTCACCCACCCCAACCCGGGCCCCAGCCTCTGGCCCAGAGAG
GATTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC229781 representing NM_001178020
Red=Cloning site Green=Tags(s)

MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRQARLQRH
RHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGDVDATVLREL
YPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSM
DTLPPYEAVCGAGPPSGLLPLPGPDPGPRGSQGSPTPTRAPASGPERIV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001178020
ORF Size 777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001178020.3
RefSeq ORF 780 bp
Locus ID 146227
UniProt ID Q3B7T3
Cytogenetics 16q21
Protein Families Transmembrane
MW 29.1 kDa
Summary The protein encoded by this gene is one of several proteins that interact with NEDD4, a member of a family of ubiquitin-protein ligases. These proteins have PY motifs in common that bind to the WW domains of NEDD4. NEDD4 is developmentally regulated, and is highly expressed in embryonic tissues. Mutations in this gene (i.e., intronic insertions of >100 copies of pentanucleotide repeats including a (TGGAA)n sequence) are associated with spinocerebellar ataxia type 31. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:BEAN1 (NM_001178020) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC229781L3 Lenti ORF clone of Human brain expressed, associated with NEDD4, 1 (BEAN1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC229781L4 Lenti ORF clone of Human brain expressed, associated with NEDD4, 1 (BEAN1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG229781 BEAN1 (tGFP-tagged) - Human brain expressed, associated with NEDD4, 1 (BEAN1), transcript variant 1 10 ug
$500.00
SC328419 BEAN1 (untagged)-Human brain expressed associated with Nedd4 (BEAN) transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.