RNF4 (NM_001185009) Human Tagged ORF Clone

SKU
RC229659
RNF4 (Myc-DDK-tagged)-Human ring finger protein 4 (RNF4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF4
Synonyms RES4-26; SLX5; SNURF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC229659 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTACAAGAAAGCGTCGTGGTGGAGCAATAAATTCTAGACAAGCTCAGAAGCGAACTCGGGAAGCGA
CCTCCACCCCCGAGATCTCCTTGGAAGCAGAACCCATAGAACTCGTGGAAACTGCTGGAGATGAAATTGT
GGACCTCACTTGTGAATCTTTAGAGCCTGTGGTGGTTGATCTGACTCACAATGACTCTGTTGTGATTGTT
GACGAAAGAAGAAGACCAAGGAGGAATGCTAGGAGGCTGCCCCAGGACCATGCTGACAGCTGTGTGGTGA
GCAGTGACGATGAGGAGTTGTCCAGGGACAGGGACGTATATGTGACTACCCATACTCCCAGAAACGCCAG
GGATGAGGGCGCTACAGGCCTCAGGCCCTCAGGTACTGTCAGTTGTCCCATCTGCATGGACGGATACTCA
GAGATCGTGCAGAATGGACGTCTCATCGTTTCCACAGAATGCGGCCATGTCTTCTGTAGCCAGTGCCTCC
GTGATTCCCTGAAGAATGCTAATACTTGCCCAACTTGTAGGAAAAAGATCAACCACAAACGGTACCACCC
CATTTATATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC229659 protein sequence
Red=Cloning site Green=Tags(s)

MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV
DERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYS
EIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001185009
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001185009.2
RefSeq Size 3493 bp
RefSeq ORF 573 bp
Locus ID 6047
UniProt ID P78317
Cytogenetics 4p16.3
Protein Families Transcription Factors
MW 21.3 kDa
Summary The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription repressor ZNF278/PATZ is found to interact with this protein, and thus reduce the enhancement of androgen receptor-dependent transcription mediated by this protein. Studies of the mouse and rat counterparts suggested a role of this protein in spermatogenesis. A pseudogene of this gene is found on chromosome 1.[provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:RNF4 (NM_001185009) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC229659L3 Lenti-ORF clone of RNF4 (Myc-DDK-tagged)-Human ring finger protein 4 (RNF4), transcript variant 1 10 ug
$600.00
RC229659L4 Lenti-ORF clone of RNF4 (mGFP-tagged)-Human ring finger protein 4 (RNF4), transcript variant 1 10 ug
$600.00
RG229659 RNF4 (tGFP-tagged) - Human ring finger protein 4 (RNF4), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC328297 RNF4 (untagged)-Human ring finger protein 4 (RNF4) transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.