Neuro D4 (DPF1) (NM_004647) Human Tagged ORF Clone

SKU
RC229181
DPF1 (Myc-DDK-tagged)-Human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Neuro D4
Synonyms BAF45b; NEUD4; neuro-d4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC229181 representing NM_004647
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGGCCTCAGCGCCCGCCCGACCGCTGGGAGGACCGACCCGGCGGGGACCTGCTGGGGGCAGGACC
CGGGGAGCAAGATGGCCACTGTCATCCCTGGCCCCCTGAGCCTAGGCGAGGACTTCTACCGCGAGGCCAT
CGAGCACTGCCGCAGTTACAACGCGCGCCTGTGCGCCGAGCGCAGCCTGCGACTGCCCTTCCTCGACTCG
CAGACCGGCGTGGCCCAGAACAACTGCTACATCTGGATGGAGAAGACCCACCGCGGGCCGGGTTTGGCCC
CGGGACAGATTTACACGTACCCCGCCCGCTGTTGGAGGAAGAAACGGAGACTCAACATCCTGGAGGACCC
CAGACTCAGGCCCTGCGAGTACAAGATCGACTGTGAAGCACCCCTGAAGAAGGAGGGTGGCCTCCCGGAA
GGGCCGGTCCTCGAGGCTCTACTGTGTGCAGAGACGGGGGAGAAGAAGATTGAGCTGAAGGAGGAGGAGA
CCATTATGGACTGTCAGAAACAGCAGTTGCTGGAGTTTCCGCATGACCTCGAGGTGGAAGACTTGGAGGA
TGACATTCCCAGGAGGAAGAACAGGGCCAAAGGAAAGGCATATGGCATCGGGGGTCTCCGGAAACGCCAG
GACACCGCTTCCCTGGAGGACCGAGACAAGCCGTATGTCTGTGATAAGTTTTACAAAGAATTGGCCTGGG
TCCCTGAGGCACAAAGGAAACACACAGCCAAGAAGGCGCCCGACGGCACTGTCATCCCCAACGGCTACTG
TGACTTCTGCCTGGGGGGCTCCAAGAAGACGGGGTGTCCCGAGGACCTCATCTCCTGTGCGGACTGTGGG
CGATCAGGACACCCCTCGTGTTTACAATTCACGGTGAACATGACGGCAGCCGTGCGGACCTACCGCTGGC
AGTGCATCGAGTGCAAATCCTGCAGCCTGTGCGGAACCTCCGAGAACGACGGTGCCAGCTGGGCGGGTCT
CACCCCCCAGGACCAGCTGCTGTTTTGTGATGACTGCGATCGGGGTTACCACATGTACTGCCTGAGTCCC
CCCATGGCGGAGCCCCCGGAAGGGAGCTGGAGCTGTCACCTCTGTCTCCGGCACCTGAAGGAAAAGGCTT
CTGCTTACATCACCCTCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC229181 representing NM_004647
Red=Cloning site Green=Tags(s)

MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS
QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE
GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ
DTASLEDRDKPYVCDKFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCG
RSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSP
PMAEPPEGSWSCHLCLRHLKEKASAYITLT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004647
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004647.3, NP_004638.2
RefSeq ORF 1062 bp
Locus ID 8193
UniProt ID Q92782
Cytogenetics 19q13.2
Domains PHD
Protein Families Druggable Genome, Transcription Factors
MW 42.3 kDa
Summary May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Neuro D4 (DPF1) (NM_004647) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC229181L3 Lenti ORF clone of Human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC229181L4 Lenti ORF clone of Human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2, mGFP tagged 10 ug
$757.00
RG229181 DPF1 (tGFP-tagged) - Human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2 10 ug
$657.00
SC117249 DPF1 (untagged)-Human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2 10 ug
$457.00
SC327816 DPF1 (untagged)-Human D4 zinc and double PHD fingers family 1 (DPF1) transcript variant 2 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.