THEM2 (ACOT13) (NM_001160094) Human Tagged ORF Clone

SKU
RC228056
ACOT13 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 13 (ACOT13), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol THEM2
Synonyms HT012; PNAS-27; THEM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC228056 representing NM_001160094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTAGAAAGATTACTCTTGTCTCTGCTGCTCCTGGGAAAGTGATTTGTGAAATGAAAGTAGAAGAAG
AGCATACCAATGCAATAGGCACTCTCCACGGCGGTTTGACAGCCACGTTAGTAGATAACATATCAACAAT
GGCTCTGCTATGCACGGAAAGGGGAGCACCCGGAGTCAGTGTCGATATGAACATAACGTACATGTCACCT
GCAAAATTAGGAGAAGATATAGTGATTACAGCACATGTTCTGAAGCAAGGAAAAACACTTGCATTTACCT
CTGTGGATCTGACCAACAAGGCCACAGGAAAATTAATAGCACAAGGAAGACACACAAAACACCTGGGAAA
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC228056 representing NM_001160094
Red=Cloning site Green=Tags(s)

MVRKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAPGVSVDMNITYMSP
AKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001160094
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001160094.1, NP_001153566.1
RefSeq ORF 354 bp
Locus ID 55856
UniProt ID Q9NPJ3
Cytogenetics 6p22.3
MW 12.2 kDa
Summary This gene encodes a member of the thioesterase superfamily. In humans, the protein co-localizes with microtubules and is essential for sustained cell proliferation. The orthologous mouse protein forms a homotetramer and is associated with mitochondria. The mouse protein functions as a medium- and long-chain acyl-CoA thioesterase. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2009]
Write Your Own Review
You're reviewing:THEM2 (ACOT13) (NM_001160094) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC228056L3 Lenti-ORF clone of ACOT13 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 13 (ACOT13), transcript variant 2 10 ug
$465.00
RC228056L4 Lenti-ORF clone of ACOT13 (mGFP-tagged)-Human acyl-CoA thioesterase 13 (ACOT13), transcript variant 2 10 ug
$465.00
RG228056 ACOT13 (tGFP-tagged) - Human acyl-CoA thioesterase 13 (ACOT13), transcript variant 2 10 ug
$365.00
SC326691 ACOT13 (untagged)-Human acyl-CoA thioesterase 13 (ACOT13) transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.