TCF3 / E2A (TCF3) (NM_001136139) Human Tagged ORF Clone

CAT#: RC227647

Reviews ()
Write a review

TCF3 (Myc-DDK-tagged)-Human transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) (TCF3), transcript variant 2



Reconstitution Protocol

USD 606.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TCF3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TCF3
Synonyms AGM8; bHLHb21; E2A; E47; ITF1; p75; TCF-3; VDIR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC227647 representing NM_001136139
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCAGCCGCAGAGGATGGCGCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCA
TGATGTTCCCGCTGCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGG
TTCAGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTCCTTTGAC
CCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCTCTCTTCATCCACATTCC
TGGGACCGGGACTCGGAGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGT
GGGCGGCCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTCCCCT
TCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCGGAGAGCGGCAGACG
GCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGGTCTTCCATCCTCGGTGTACCCACC
CAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTAT
CCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGG
CGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGG
CAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGA
GCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCG
TCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAG
CTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCG
TCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAG
CCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCT
GGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGTGACATGCACACGCTGCTGCCT
GGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTG
GAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAG
CCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCC
ACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACT
CGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCT
GGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGG
GATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGA
CCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAA
CCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCC
CAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227647 representing NM_001136139
Red=Cloning site Green=Tags(s)

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFD
PSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSP
SGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTY
PAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHG
AEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFS
SSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGA
TAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVR
DINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDP
QMVLSAPHPGLSEAHNPAGHM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001136139
ORF Size 1953 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001136139.4
RefSeq ORF 1956 bp
Locus ID 6929
UniProt ID P15923
Cytogenetics 19p13.3
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
MW 67.1 kDa
Gene Summary This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Sep 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.