SMAD6 (NM_001142861) Human Tagged ORF Clone

SKU
RC227610
SMAD6 (Myc-DDK-tagged)-Human SMAD family member 6 (SMAD6), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SMAD6
Synonyms AOVD2; HsT17432; MADH6; MADH7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC227610 representing NM_001142861
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAGAATGGGCAAACCCATAGAGACACAAAAATCTCCGCCACCTCCCTACTCTCGGCTGTCTCCTC
GCGACGAGTACAAGCCACTGGATCTGTCCGATTCCACATTGTCTTACACTGAAACGGAGGCTACCAACTC
CCTCATCACTGCTCCGGGTGAATTCTCAGACGCCAGCATGTCTCCGGACGCCACCAAGCCGAGCCACTGG
TGCAGCGTGGCGTACTGGGAGCACCGGACGCGCGTGGGCCGCCTCTATGCGGTGTACGACCAGGCCGTCA
GCATCTTCTACGACCTACCTCAGGGCAGCGGCTTCTGCCTGGGCCAGCTCAACCTGGAGCAGCGCAGCGA
GTCGGTGCGGCGAACGCGCAGCAAGATCGGCTTCGGCATCCTGCTCAGCAAGGAGCCCGACGGCGTGTGG
GCCTACAACCGCGGCGAGCACCCCATCTTCGTCAACTCCCCGACGCTGGACGCGCCCGGCGGCCGCGCCC
TGGTCGTGCGCAAGGTGCCCCCCGGCTACTCCATCAAGGTGTTCGACTTCGAGCGCTCGGGCCTGCAGCA
CGCGCCCGAGCCCGACGCCGCCGACGGCCCCTACGACCCCAACAGCGTCCGCATCAGCTTCGCCAAGGGC
TGGGGGCCCTGCTACTCCCGGCAGTTCATCACCTCCTGCCCCTGCTGGCTGGAGATCCTCCTCAACAACC
CCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC227610 representing NM_001142861
Red=Cloning site Green=Tags(s)

MSRMGKPIETQKSPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHW
CSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVW
AYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKG
WGPCYSRQFITSCPCWLEILLNNPR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001142861
ORF Size 705 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001142861.2, NP_001136333.1
RefSeq ORF 708 bp
Locus ID 4091
Cytogenetics 15q22.31
Protein Families Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways TGF-beta signaling pathway
MW 26.1 kDa
Summary The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants have been found for this gene.[provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:SMAD6 (NM_001142861) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227610L1 Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC227610L2 Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, mGFP tagged 10 ug
$750.00
RC227610L3 Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC227610L4 Lenti ORF clone of Human SMAD family member 6 (SMAD6), transcript variant 2, mGFP tagged 10 ug
$750.00
RG227610 SMAD6 (tGFP-tagged) - Human SMAD family member 6 (SMAD6), transcript variant 2 10 ug
$650.00
SC325641 SMAD6 (untagged)-Human SMAD family member 6 (SMAD6), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.