LY6H (NM_001135655) Human Tagged ORF Clone

SKU
RC227543
LY6H (Myc-DDK-tagged)-Human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LY6H
Synonyms NMLY6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC227543 representing NM_001135655
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTGCGCCCCAGAGGACCCGCGCCCCAAGCCCCCGCGCCGCCCCCAGGCCCACCCGGAGCATGCTGC
CTGCAGCCATGAAGGGCCTCGGCCTGGCGCTGCTGGCCGTCCTGCTGTGCTCGGCGCCCGCTCATGGCCT
GTGGTGCCAGGACTGCACCCTGACCACCAACTCCAGCCATTGCACCCCAAAGCAGTGCCAGCCGTCCGAC
ACGGTGTGTGCCAGTGTCCGAATCACCGATCCCAGCAGCAGCAGGAAGGATCACTCGGTGAACAAGATGT
GTGCCTCCTCCTGTGACTTCGTTAAGCGACACTTTTTCTCAGACTATCTGATGGGGTTTATTAACTCTGG
GATCTTAAAGGTCGACGTGGACTGCTGCGAGAAGGATTTGTGCAATGGGGCGGCAGGGGCAGGGCACAGC
CCCTGGGCCCTGGCCGGGGGGCTCCTGCTCAGCCTGGGGCCTGCCCTCCTCTGGGCTGGGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC227543 representing NM_001135655
Red=Cloning site Green=Tags(s)

MLAPQRTRAPSPRAAPRPTRSMLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSD
TVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHS
PWALAGGLLLSLGPALLWAGP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001135655
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001135655.2
RefSeq Size 986 bp
RefSeq ORF 486 bp
Locus ID 4062
UniProt ID O94772
Cytogenetics 8q24.3
MW 17 kDa
Summary Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LY6H (NM_001135655) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227543L3 Lenti-ORF clone of LY6H (Myc-DDK-tagged)-Human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 3 10 ug
$465.00
RC227543L4 Lenti-ORF clone of LY6H (mGFP-tagged)-Human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 3 10 ug
$465.00
RG227543 LY6H (tGFP-tagged) - Human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 3 10 ug
$365.00
SC324752 LY6H (untagged)-Human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.