DAZAP2 (NM_001136264) Human Tagged ORF Clone

SKU
RC227525
DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DAZAP2
Synonyms PRTB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC227525 representing NM_001136264
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAGCAAAGGTCAATATCCAACACAGCCAACCTACCCTGTGCAGCCTCCTGGGAATCCAGTATACC
CTCAGACCTTGCATCTTCCTCAGGCTCCACCCTATACCGATGCTCCACCTGCCTACTCAGAGCTCTATCG
TCCGAGCTTTGTGCACCCAGGGGCTGCCACAGTCCCCACCATGTCAGCCGCAATCCCCATGGCTTATTAT
CCAGTCGGTCCCATCTATCCACCTGGCTCCACAGTGCTGGTGGAAGGAGGGTATGATGCAGGTGCCAGAT
TTGGAGCTGGGGCTACTGCTGGCAACATTCCTCCTCCACCTCCTGGATGCCCTCCCAATGCTGCTCAGCT
TGCAGTCATGCAGGGAGCCAACGTCCTCGTAACTCAGCGGAAGGGGAACTTCTTCATGGGTGGTTCAGAT
GGTGGCTACACCATCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC227525 representing NM_001136264
Red=Cloning site Green=Tags(s)

MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAIPMAYY
PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSD
GGYTIW

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001136264
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001136264.1, NP_001129736.1
RefSeq ORF 441 bp
Locus ID 9802
UniProt ID Q15038
Cytogenetics 12q13.13
MW 15 kDa
Summary This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:DAZAP2 (NM_001136264) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227525L3 Lenti-ORF clone of DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 2 10 ug
$465.00
RC227525L4 Lenti-ORF clone of DAZAP2 (mGFP-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 2 10 ug
$465.00
RG227525 DAZAP2 (tGFP-tagged) - Human DAZ associated protein 2 (DAZAP2), transcript variant 2 10 ug
$365.00
SC325516 DAZAP2 (untagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.