WIBG (PYM1) (NM_001143853) Human Tagged ORF Clone
SKU
RC227106
WIBG (Myc-DDK-tagged)-Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | WIBG |
Synonyms | PYM; WIBG |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC227106 representing NM_001143853
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACTCCCTATGTTACTGACGAGACCGGCGGCAAGTATATCGCGTCAACACAGCGACCTGACGGGA CCTGGCGCAAGCAGCGGAGGGTGAAAGAAGGATATGTGCCCCAGGAGGAGGTCCCAGTATATGAAAACAA GTATGTGAAGTTTTTCAAGAGTAAACCAGAGTTGCCCCCAGGGCTAAGCCCTGAGGCCACTGCTCCTGTC ACCCCATCCAGGCCTGAAGGTGGTGAACCAGGCCTCTCCAAGACAGCCAAACGTAACCTGAAGCGAAAGG AGAAGAGGCGGCAGCAGCAAGAGAAAGGAGAGGCAGAGGCCTTGAGCAGGACTCTTGATAAGGTGTCCCT GGAAGAGACAGCCCAACTCCCCAGTGCTCCACAGGGCTCTCGGGCAGCCCCCACAGCTGCATCTGACCAG CCTGACTCAGCTGCCACCACTGAGAAAGCCAAGAAGATAAAGAACCTAAAGAAGAAACTCCGGCAGGTGG AAGAGCTGCAGCAGCGGATCCAGGCTGGGGAAGTCAGCCAGCCCAGCAAAGAGCAGCTAGAAAAGCTAGC AAGGAGGAGGGCGCTAGAAGAGGAGTTAGAGGACTTGGAGTTAGGCCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC227106 representing NM_001143853
Red=Cloning site Green=Tags(s) MATPYVTDETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPV TPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQ PDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001143853 |
ORF Size | 609 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001143853.1, NP_001137325.1 |
RefSeq ORF | 612 bp |
Locus ID | 84305 |
UniProt ID | Q9BRP8 |
Cytogenetics | 12q13.2 |
MW | 22.5 kDa |
Summary | Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC227106L1 | Lenti ORF clone of Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC227106L2 | Lenti ORF clone of Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RC227106L3 | Lenti ORF clone of Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC227106L4 | Lenti ORF clone of Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, mGFP tagged | 10 ug |
$600.00
|
|
RG227106 | WIBG (tGFP-tagged) - Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 | 10 ug |
$500.00
|
|
SC325597 | WIBG (untagged)-Human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.