FKBP51 (FKBP5) (NM_001145777) Human Tagged ORF Clone

SKU
RC227059
FKBP5 (Myc-DDK-tagged)-Human FK506 binding protein 5 (FKBP5), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FKBP51
Synonyms AIG6; FKBP51; FKBP54; P54; PPIase; Ptg-10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC227059 representing NM_001145777
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACTGATGAAGGTGCCAAGAACAATGAAGAAAGCCCCACAGCCACTGTTGCTGAGCAGGGAGAGG
ATATTACCTCCAAAAAAGACAGGGGAGTATTAAAGATTGTCAAAAGAGTGGGGAATGGTGAGGAAACGCC
GATGATTGGAGACAAAGTTTATGTCCATTACAAAGGAAAATTGTCAAATGGAAAGAAGTTTGATTCCAGT
CATGATAGAAATGAACCATTTGTCTTTAGTCTTGGCAAAGGCCAAGTCATCAAGGCATGGGACATTGGGG
TGGCTACCATGAAGAAAGGAGAGATATGCCATTTACTGTGCAAACCAGAATATGCATATGGCTCGGCTGG
CAGTCTCCCTAAAATTCCCTCGAATGCAACTCTCTTTTTTGAGATTGAGCTCCTTGATTTCAAAGGAGAG
GATTTATTTGAAGATGGAGGCATTATCCGGAGAACCAAACGGAAAGGAGAGGGATATTCAAATCCAAACG
AAGGAGCAACAGTAGAAATCCACCTGGAAGGCCGCTGTGGTGGAAGGATGTTTGACTGCAGAGATGTGGC
ATTCACTGTGGGCGAAGGAGAAGACCACGACATTCCAATTGGAATTGACAAAGCTCTGGAGAAAATGCAG
CGGGAAGAACAATGTATTTTATATCTTGGACCAAGGCCAAAGAATCCTGGGAGATGGATACCAAAGAAAA
ATTGGAGCAGGCTGCCATTGTCAAAGAGAAGGGAACCGTATACTTCAAGGTGTGTGAGTCCCTATGCAAT
CCTTTCCATCTCAAAGAATTTATTCAAGTGTTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC227059 representing NM_001145777
Red=Cloning site Green=Tags(s)

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSS
HDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
DLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQ
REEQCILYLGPRPKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001145777
ORF Size 804 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001145777.1, NP_001139249.1
RefSeq ORF 807 bp
Locus ID 2289
UniProt ID Q13451
Cytogenetics 6p21.31
Protein Families Druggable Genome
MW 29.9 kDa
Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:FKBP51 (FKBP5) (NM_001145777) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227059L1 Lenti ORF clone of Human FK506 binding protein 5 (FKBP5), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC227059L2 Lenti ORF clone of Human FK506 binding protein 5 (FKBP5), transcript variant 4, mGFP tagged 10 ug
$600.00
RC227059L3 Lenti ORF clone of Human FK506 binding protein 5 (FKBP5), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC227059L4 Lenti ORF clone of Human FK506 binding protein 5 (FKBP5), transcript variant 4, mGFP tagged 10 ug
$600.00
RG227059 FKBP5 (tGFP-tagged) - Human FK506 binding protein 5 (FKBP5), transcript variant 4 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC326544 FKBP5 (untagged)-Human FK506 binding protein 5 (FKBP5), transcript variant 4, mRNA 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.