SPATA24 (NM_194296) Human Tagged ORF Clone

SKU
RC226669
SPATA24 (Myc-DDK-tagged)-Human spermatogenesis associated 24 (SPATA24)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPATA24
Synonyms CCDC161; T6441
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC226669 representing NM_194296
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACGCCCCTCGGGTGGTCGAAGGCGGGGTCAGGATCTGTGTGTCTCGCTTTAGATCAACTGCGGG
ACGTGATTGAGTCTCAGGAGGAACTAATCCACCAGCTGAGGAACGTGATGGTTCTCCAGGACGAAAATTT
TGTCAGTAAAGAAGAGTTCCAGGCAGTGGAGAAGAAGCTGGTGGAAGAGAAAGCTGCCCATGCCAAAACC
AAGGTCCTCCTGGCCAAGGAAGAGGAGAAGTTACAGTTTGCCCTCGGAGAGGTAGAGGTGCTATCCAAGC
AGCTGGAGAAAGAGAAGCTGGCCTTTGAAAAAGCGCTCTCCAGTGTCAAGAGCAAAGTCCTTCAGGAGTC
CAGCAAGAAGGACCAGCTCATCACCAAGTGCAATGAGATTGAGTCTCACATTATAAAGCAAGAAGATATA
CTTAATGGCAAAGAGAATGAGATTAAAGAGTTGCAGCAAGTTATCAGCCAGCAGAAACAGATCTTCAGGA
ATCACATGTCTGACTTCCGGATCCAGAAGCAGCAGGAGAGCTACATGGCCCAGGTGCTGGACCAGAAGCA
TAAGAAAGCCTCAGGGACACGTCAGGCCCGCAGCCACCAGCATCCCAGGGAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226669 representing NM_194296
Red=Cloning site Green=Tags(s)

MATPLGWSKAGSGSVCLALDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKT
KVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLITKCNEIESHIIKQEDI
LNGKENEIKELQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQHPREK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_194296
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194296.2
RefSeq ORF 618 bp
Locus ID 202051
UniProt ID Q86W54
Cytogenetics 5q31.2
MW 23.4 kDa
Summary Binds DNA with high affinity but does not bind to TATA boxes. Synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter. May play a role in cytoplasm movement and removal during spermiogenesis (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SPATA24 (NM_194296) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC226669L3 Lenti ORF clone of Human spermatogenesis associated 24 (SPATA24), Myc-DDK-tagged 10 ug
$600.00
RC226669L4 Lenti ORF clone of Human spermatogenesis associated 24 (SPATA24), mGFP tagged 10 ug
$600.00
RG226669 SPATA24 (tGFP-tagged) - Human spermatogenesis associated 24 (SPATA24) 10 ug
$500.00
SC325602 SPATA24 (untagged)-Human spermatogenesis associated 24 (SPATA24) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.