CRYZ (NM_001130043) Human Tagged ORF Clone

SKU
RC225403
CRYZ (Myc-DDK-tagged)-Human crystallin, zeta (quinone reductase) (CRYZ), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CRYZ
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225403 representing NM_001130043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACTGGACAGAAGTTGATGAGAGCTGTTAGAGTTTTTGAATTTGGTGGGCCAGAAGTCCTGAAAT
TGCGATCAGATATTGCAGTACCGATTCCAAAAGACCATCAGGTTCTAATCAAGGTCCATGCATGTGGTGT
CAACCCCGTGGAGACATACATTCGCTCTGGTACTTATAGTAGAAAACCACTCTTACCCTATACTCCTGGC
TCAGATGTGGCTGGGGTGATAGAAGCTGTTGGAGATAATGCATCTGCTTTCAAGAAAGGTGACAGAGTTT
TCACTAGCAGCACGATCTCTGGGGGTTATGCAGAGTATGCTCTTGCAGCAGACCACACTGTTTACAAACT
ACCTGAAAAACTGGACTTTAAACAAGGAGCTGCCATCGGCATTCCATATTTTACTGCTTATCGAGCTCTG
ATCCACAGTGCCTGTGTGAAAGCTGGAGAGAGTGTTCTGGTTCATGGGGCAAGTGGAGGAGTTGGATTAG
CAGCATGCCAAATTGCTAGAGCTTATGGCTTAAAGATTTTGGGCACTGCTGGTACTGAGGAAGGACAAAA
GATTGTTTTGCAAAATGGAGCCCATGAAGTGTTCAATCACAGAGAAGTGAATTACATTGATAAAATTAAG
GTTGTTGGCAGCAGAGGTACTATTGAAATAAACCCACGAGACACCATGGCAAAGGAGTCGAGTATAATTG
GAGTTACTCTCTTTTCCTCAACCAAGGAGGAATTTCAGCAATATGCAGCAGCCCTTCAAGCTGGAATGGA
AATTGGCTGGTTGAAACCTGTGATAGGTTCTCAATATCCATTGGAGAAGGTGGCCGAGGCTCATGAAAAT
ATCATTCATGGTAGTGGGGCTACTGGAAAAATGATTCTTCTCTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225403 representing NM_001130043
Red=Cloning site Green=Tags(s)

MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPG
SDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRAL
IHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK
VVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHEN
IIHGSGATGKMILLL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001130043
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001130043.1, NP_001123515.1
RefSeq ORF 888 bp
Locus ID 1429
UniProt ID Q08257
Cytogenetics 1p31.1
Protein Families Druggable Genome
MW 31.3 kDa
Summary Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist. [provided by RefSeq, Sep 2008]
Write Your Own Review
You're reviewing:CRYZ (NM_001130043) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225403L3 Lenti ORF clone of Human crystallin, zeta (quinone reductase) (CRYZ), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC225403L4 Lenti ORF clone of Human crystallin, zeta (quinone reductase) (CRYZ), transcript variant 3, mGFP tagged 10 ug
$600.00
RG225403 CRYZ (tGFP-tagged) - Human crystallin, zeta (quinone reductase) (CRYZ), transcript variant 3 10 ug
$500.00
SC322955 CRYZ (untagged)-Human crystallin, zeta (quinone reductase) (CRYZ), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.