PPP1R14D (NM_001130143) Human Tagged ORF Clone

SKU
RC225226
PPP1R14D (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPP1R14D
Synonyms CPI17-like; GBPI-1; GBPI1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225226 representing NM_001130143
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTTCAAGCCCTGCTTCCTGCACATCTCCCAGCCCAGATGGGGAGAACCCATGTAAGAAGGTCC
ACTGGGCTTCTGGGAGGAGAAGGACATCATCCACAGACTCAGAGTCCAAGTCCCACCCGGACTCCTCCAA
GATACCCAGGTCCCGGAGACCCAGCCGCCTGACAGTGAAGTATGACCGGGGCCAGCTCCAGCGCTGGCTG
GAGATGGAGCAATGGGTGGATGCTCAAGTTCAGGAGCTCTTCCAGAGTCTTGCTCTGTCACCCAGGCTGG
AGTGCAGTGGTGTGATCCATTCTCTGCAACTTCTGCCTCCCGGGTTCAATCGATTCTCCTGCCTCAGCTC
CTGGAGTAGCTGGGATTACGGGATCAAGCAACCCCTTCTGAGCCTGAGATTGACCTGGAAGCTCTCATGG
ATCTATCCACAGAGGAGCAGAAGACTCAGCTGGAGGCCATTCTTGGGAACTGCCCCCGCCCCACAGAGGC
TTTTATCTCTGAGCTGCTCAGTCAACTCAAGAAACTCCGGAGACTCAGCCGGCCTCAGAAATAAGCCTGA
GAGACCATCTTTAGCAGCCTCAGCACTGCCAGGCCTGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225226 representing NM_001130143
Red=Cloning site Green=Tags(s)

MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWL
EMEQWVDAQVQELFQSLALSPRLECSGVIHSLQLLPPGFNRFSCLSSWSSWDYGIKQPLLSLRLTWKLSW
IYPQRSRRLSWRPFLGTAPAPQRLLSLSCSVNSRNSGDSAGLRNKPERPSLAASALPGLP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001130143
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001130143.2
RefSeq ORF 603 bp
Locus ID 54866
Cytogenetics 15q15.1
Protein Families Druggable Genome
MW 22.2 kDa
Summary Protein phosphatase-1 (PP1; see MIM 176875) is a major cellular phosphatase that reverses serine/threonine protein phosphorylation. PPP1R14D is a PP1 inhibitor that itself is regulated by phosphorylation (Liu et al., 2004 [PubMed 12974676]).[supplied by OMIM, Feb 2010]
Write Your Own Review
You're reviewing:PPP1R14D (NM_001130143) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225226L3 Lenti-ORF clone of PPP1R14D (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 2 10 ug
$630.00
RC225226L4 Lenti-ORF clone of PPP1R14D (mGFP-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 2 10 ug
$630.00
RG225226 PPP1R14D (tGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 2 10 ug
$530.00
SC325595 PPP1R14D (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 14D (PPP1R14D), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.