Cytochrome b reductase 1 (CYBRD1) (NM_001127383) Human Tagged ORF Clone

SKU
RC225139
CYBRD1 (Myc-DDK-tagged)-Human cytochrome b reductase 1 (CYBRD1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cytochrome b reductase 1
Synonyms CYB561A2; DCYTB; FRRS3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225139 representing NM_001127383
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGGAGGGCTACTGGCGCTTCCTGGCGCTGCTGGGGTCGGCACTGCTCGTCGGCTTCCTGTCGG
TGATCTTCGCCCTCGTCTGGGTCCTCCACTACCGAGAGGGGCTTGGCTGGGATGGGAGCGCACTAGAGTT
TAACTGGCACCCAGTGCTCATGGTCACCGGCTTCGTCTTCATCCAGGGCATCGCTTCTTTCAGGTTTTTC
AGTCTTTCTGCTTCCATGGGCTCCGCTTTCTCTCCGAGCATTTCTCATGCCCATACATGTTTATTCTGGA
ATTGTCATCTTTGGAACAGTGATTGCAACAGCACTTATGGGATTGACAGAGAAACTGATTTTTTCCCTGA
GAGATCCTGCATACAGTACATTCCCGCCAGAAGGTGTTTTCGTAAATACGCTTGGCCTTCTGATCCTGGT
GTTCGGGGCCCTCATTTTTTGGATAGTCACCAGACCGCAATGGAAACGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225139 representing NM_001127383
Red=Cloning site Green=Tags(s)

MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIASFRFF
SLSASMGSAFSPSISHAHTCLFWNCHLWNSDCNSTYGIDRETDFFPERSCIQYIPARRCFRKYAWPSDPG
VRGPHFLDSHQTAMETS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001127383
ORF Size 471 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001127383.2
RefSeq ORF 474 bp
Locus ID 79901
UniProt ID Q53TN4
Cytogenetics 2q31.1
Protein Families Transmembrane
MW 17.7 kDa
Summary This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Cytochrome b reductase 1 (CYBRD1) (NM_001127383) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225139L1 Lenti ORF clone of Human cytochrome b reductase 1 (CYBRD1), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC225139L2 Lenti ORF clone of Human cytochrome b reductase 1 (CYBRD1), transcript variant 2, mGFP tagged 10 ug
$450.00
RC225139L3 Lenti ORF clone of Human cytochrome b reductase 1 (CYBRD1), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC225139L4 Lenti ORF clone of Human cytochrome b reductase 1 (CYBRD1), transcript variant 2, mGFP tagged 10 ug
$450.00
RG225139 CYBRD1 (tGFP-tagged) - Human cytochrome b reductase 1 (CYBRD1), transcript variant 2 10 ug
$350.00
SC322853 CYBRD1 (untagged)-Human cytochrome b reductase 1 (CYBRD1), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.