FXYD2 (NM_001127489) Human Tagged ORF Clone
SKU
RC225122
FXYD2 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | FXYD2 |
Synonyms | ATP1G1; HOMG2; MGC12372 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC225122 representing NM_001127489
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGGTAAGC CTGGGCCCCTGCGCACCCTTCCTGAGCCCTCAGGACCCCTTCCACCAAGCAGCGGCCTCTCCCAGCCCCA GGTCCATGCTCTGTGCCCCTTATCTCCCCTGGTTACCACGGGCTGCTGCGGGCAGGCTGCGGAGAGAGAC AGCTGCTGGGAGAGACCACCCATCCCGCTCCTCTTGCCCTCTCTTTCCGGAGACTATGAGACCGTTCGCA ATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGTAAGTGGGGTGG CCTCCAGGGAAGGGGTGCTGACCAGGGCACCTCTCTTCTCAAGGCCGCTGAGCAGGCTGGCTTTCGGGAG TTGCCAAGGGAGGGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC225122 representing NM_001127489
Red=Cloning site Green=Tags(s) MTGLSMDGGGSPKGDVDPFYYGKPGPLRTLPEPSGPLPPSSGLSQPQVHALCPLSPLVTTGCCGQAAERD SCWERPPIPLLLPSLSGDYETVRNGGLIFAGLAFIVGLLILLSKWGGLQGRGADQGTSLLKAAEQAGFRE LPREG myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001127489 |
ORF Size | 435 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001127489.1, NP_001120961.1 |
RefSeq ORF | 437 bp |
Locus ID | 486 |
Cytogenetics | 11q23.3 |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
MW | 14.9 kDa |
Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC225122L1 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC225122L2 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, mGFP tagged | 10 ug |
$450.00
|
|
RC225122L3 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC225122L4 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, mGFP tagged | 10 ug |
$450.00
|
|
RG225122 | FXYD2 (tGFP-tagged) - Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c | 10 ug |
$350.00
|
|
SC322850 | FXYD2 (untagged)-Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c | 10 ug |
$165.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.