FXYD2 (NM_001127489) Human Tagged ORF Clone

SKU
RC225122
FXYD2 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FXYD2
Synonyms ATP1G1; HOMG2; MGC12372
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225122 representing NM_001127489
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGGTAAGC
CTGGGCCCCTGCGCACCCTTCCTGAGCCCTCAGGACCCCTTCCACCAAGCAGCGGCCTCTCCCAGCCCCA
GGTCCATGCTCTGTGCCCCTTATCTCCCCTGGTTACCACGGGCTGCTGCGGGCAGGCTGCGGAGAGAGAC
AGCTGCTGGGAGAGACCACCCATCCCGCTCCTCTTGCCCTCTCTTTCCGGAGACTATGAGACCGTTCGCA
ATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGTAAGTGGGGTGG
CCTCCAGGGAAGGGGTGCTGACCAGGGCACCTCTCTTCTCAAGGCCGCTGAGCAGGCTGGCTTTCGGGAG
TTGCCAAGGGAGGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225122 representing NM_001127489
Red=Cloning site Green=Tags(s)

MTGLSMDGGGSPKGDVDPFYYGKPGPLRTLPEPSGPLPPSSGLSQPQVHALCPLSPLVTTGCCGQAAERD
SCWERPPIPLLLPSLSGDYETVRNGGLIFAGLAFIVGLLILLSKWGGLQGRGADQGTSLLKAAEQAGFRE
LPREG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001127489
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001127489.1, NP_001120961.1
RefSeq ORF 437 bp
Locus ID 486
Cytogenetics 11q23.3
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
MW 14.9 kDa
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:FXYD2 (NM_001127489) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225122L1 Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, Myc-DDK-tagged 10 ug
$450.00
RC225122L2 Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, mGFP tagged 10 ug
$450.00
RC225122L3 Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, Myc-DDK-tagged 10 ug
$450.00
RC225122L4 Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c, mGFP tagged 10 ug
$450.00
RG225122 FXYD2 (tGFP-tagged) - Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c 10 ug
$350.00
SC322850 FXYD2 (untagged)-Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.