SYCE3 (NM_001123225) Human Tagged ORF Clone

SKU
RC225004
SYCE3 (Myc-DDK-tagged)-Human chromosome 22 open reading frame 41 (C22orf41)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SYCE3
Synonyms C22orf41; THEG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225004 representing NM_001123225
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGATGCTGACCCTGAGGAAAGAAACTATGACAACATGCTGAAAATGCTGTCAGATCTGAATAAGG
ACTTGGAAAAGCTATTAGAAGAGATGGAGAAAATCTCAGTGCAGGCGACCTGGATGGCCTATGACATGGT
GGTGATGCGCACCAACCCTACGCTGGCCGAGTCCATGCGTCGGCTGGAGGATGCCTTCGTCAACTGCAAG
GAGGAGATGGAGAAGAACTGGCAAGAGCTGCTGCATGAGACCAAGCAAAGGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225004 representing NM_001123225
Red=Cloning site Green=Tags(s)

MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK
EEMEKNWQELLHETKQRL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001123225
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001123225.3
RefSeq ORF 267 bp
Locus ID 644186
UniProt ID A1L190
Cytogenetics 22q13.33
MW 10.4 kDa
Summary Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SYCE3 (NM_001123225) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225004L3 Lenti ORF clone of Human chromosome 22 open reading frame 41 (C22orf41), Myc-DDK-tagged 10 ug
$450.00
RC225004L4 Lenti ORF clone of Human chromosome 22 open reading frame 41 (C22orf41), mGFP tagged 10 ug
$450.00
RG225004 SYCE3 (tGFP-tagged) - Human chromosome 22 open reading frame 41 (C22orf41) 10 ug
$350.00
SC318758 SYCE3 (untagged)-Human chromosome 22 open reading frame 41 (C22orf41) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.