Nogo B receptor (NUS1) (NM_138459) Human Tagged ORF Clone

SKU
RC224928
NUS1 (Myc-DDK-tagged)-Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Nogo B receptor
Synonyms C6orf68; CDG1AA; MGC:7199; MRD55; NgBR; TANGO14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224928 representing NM_138459
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGGGCTGTACGAGCTGGTGTGGCGGGTGCTGCACGCGCTGCTCTGTCTGCACCGCACGCTCACCT
CCTGGCTCCGCGTTCGGTTCGGCACCTGGAACTGGATCTGGCGGCGCTGCTGCCGCGCCGCCTCTGCCGC
GGTCCTAGCGCCGCTCGGCTTCACGCTCCGCAAGCCCCCGGCAGTCGGCAGGAACCGCCGTCACCACCGG
CACCCGCGCGGGGGGTCGTGCCTGGCAGCCGCACACCACCGGATGCGCTGGCGCGCGGACGGTCGTTCCT
TGGAGAAGCTGCCTGTGCATATGGGCCTGGTGATCACCGAGGTGGAGCAGGAACCCAGCTTCTCGGACAT
CGCGAGCCTCGTGGTGTGGTGTATGGCCGTGGGCATCTCCTACATTAGCGTCTACGACCACCAAGGTATT
TTCAAAAGAAATAATTCCAGATTGATGGATGAAATTTTAAAACAACAGCAAGAACTTCTGGGCCTAGATT
GTTCAAAATACTCACCAGAATTTGCAAATAGTAATGACAAAGATGATCAAGTTTTAAATTGCCATTTGGC
AGTGAAGGTGCTGTCTCCGGAAGATGGAAAAGCAGATATTGTAAGAGCTGCTCAGGACTTTTGCCAGTTA
GTAGCCCAGAAGCAAAAGAGACCCACAGATTTGGATGTAGATACGTTAGCCAGTTTACTTAGTTCAAATG
GTTGTCCTGATCCTGATTTAGTATTGAAGTTCGGTCCTGTGGACAGCACATTAGGCTTTCTTCCCTGGCA
CATCAGATTGACTGAGATTGTCTCTTTGCCTTCCCACCTAAACATCAGTTATGAGGACTTTTTCTCTGCC
CTTCGTCAATATGCAGCCTGTGAACAGCGTCTGGGAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224928 representing NM_138459
Red=Cloning site Green=Tags(s)

MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHR
HPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGI
FKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQL
VAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSA
LRQYAACEQRLGK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138459
ORF Size 879 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138459.5
RefSeq Size 2636 bp
RefSeq ORF 882 bp
Locus ID 116150
UniProt ID Q96E22
Cytogenetics 6q22.1
MW 33 kDa
Summary This gene encodes a type I single transmembrane domain receptor, which is a subunit of cis-prenyltransferase, and serves as a specific receptor for the neural and cardiovascular regulator Nogo-B. The encoded protein is essential for dolichol synthesis and protein glycosylation. This gene is highly expressed in non-small cell lung carcinomas as well as estrogen receptor-alpha positive breast cancer cells where it promotes epithelial mesenchymal transition. This gene is associated with the poor prognosis of human hepatocellular carcinoma patients. Naturally occurring mutations in this gene cause a congenital disorder of glycosylation and are associated with epilepsy. A knockout of the orthologous gene in mice causes embryonic lethality before day 6.5. Pseudogenes of this gene have been defined on chromosomes 13 and X. [provided by RefSeq, May 2017]
Write Your Own Review
You're reviewing:Nogo B receptor (NUS1) (NM_138459) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224928L1 Lenti ORF clone of Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1), Myc-DDK-tagged 10 ug
$600.00
RC224928L2 Lenti ORF clone of Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1), mGFP tagged 10 ug
$600.00
RC224928L3 Lenti ORF clone of Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1), Myc-DDK-tagged 10 ug
$600.00
RC224928L4 Lenti ORF clone of Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1), mGFP tagged 10 ug
$600.00
RG224928 NUS1 (tGFP-tagged) - Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC120648 NUS1 (untagged)-Human nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) (NUS1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.