H3FL (HIST1H3B) (NM_003537) Human Tagged ORF Clone

SKU
RC224888
HIST1H3B (Myc-DDK-tagged)-Human histone cluster 1, H3b (HIST1H3B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol H3FL
Synonyms H3/l; H3C1; H3C3; H3C4; H3C6; H3C7; H3C8; H3C10; H3C11; H3C12; H3FL; HIST1H3B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224888 representing NM_003537
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGTACTAAACAGACAGCTCGGAAATCCACCGGCGGTAAAGCGCCACGCAAGCAGCTGGCTACCA
AGGCTGCTCGCAAGAGCGCGCCGGCTACCGGCGGCGTGAAAAAGCCTCACCGTTACCGCCCGGGCACTGT
GGCTCTGCGCGAGATCCGCCGCTACCAAAAGTCGACCGAGTTGCTGATTCGGAAGCTGCCGTTCCAGCGC
CTGGTGCGAGAAATCGCCCAAGACTTCAAGACCGATCTTCGCTTCCAGAGCTCTGCGGTGATGGCGCTGC
AGGAGGCTTGTGAGGCCTACTTGGTAGGGCTCTTTGAGGACACAAACCTTTGCGCCATCCATGCTAAGCG
AGTGACTATTATGCCCAAAGACATCCAGCTCGCTCGCCGCATTCGCGGAGAAAGAGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224888 representing NM_003537
Red=Cloning site Green=Tags(s)

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003537
ORF Size 408 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003537.4
RefSeq Size 472 bp
RefSeq ORF 411 bp
Locus ID 8358
UniProt ID P68431
Cytogenetics 6p22.2
Protein Pathways Systemic lupus erythematosus
MW 15.2 kDa
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]
Write Your Own Review
You're reviewing:H3FL (HIST1H3B) (NM_003537) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224888L3 Lenti ORF clone of Human histone cluster 1, H3b (HIST1H3B), Myc-DDK-tagged 10 ug
$525.00
RC224888L4 Lenti ORF clone of Human histone cluster 1, H3b (HIST1H3B), mGFP tagged 10 ug
$525.00
RG224888 HIST1H3B (tGFP-tagged) - Human histone cluster 1, H3b (HIST1H3B) 10 ug
$425.00
SC303332 HIST1H3B (untagged)-Human histone cluster 1, H3b (HIST1H3B) 10 ug
$240.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.