RNF90 (TRIM7) (NM_203293) Human Tagged ORF Clone

CAT#: RC224754

Reviews ()
Write a review

TRIM7 (Myc-DDK-tagged)-Human tripartite motif containing 7 (TRIM7), transcript variant 1



Reconstitution Protocol

USD 476.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TRIM7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIM7
Synonyms GNIP; RNF90
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224754 representing NM_203293
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTGTGGGACCGCGGACCGGCCCCGGAACCGGCGCCGAGGCTCTAGCGCTGGCGGCAGAGCTGC
AGGGCGAGGCGACGTGCTCCATCTGCCTAGAGCTCTTTCGTGAGCCGGTGTCCGTCGAGTGCGGCCACAG
CTTCTGCCGCGCCTGCATAGGGCGCTGCTGGGAGCGCCCGGGCGCGGGGTCTGTTGGGGCCGCCACCCGC
GCGCCCCCCTTCCCACTGCCCTGTCCGCAGTGCCGCGAGCCCGCGCGCCCCAGTCAGCTGCGGCCCAACC
GGCAGCTGGCGGCAGTGGCCACGCTCCTGCGGCGCTTCAGCCTGCCCGCGGCTGCCCCGGGAGAGCACGG
GTCTCAGGCGGCCGCGGCCCGGGCAGCGGCTGCCCGCTGCGGGCAGCATGGCGAACCCTTCAAGCTCTAC
TGCCAGGACGACGGACGCGCCATCTGCGTGGTGTGCGACCGCGCCCGCGAGCACCGCGAGCACGCCGTGC
TGCCGCTGGACGAGGCGGTGCAGGAGGCCAAGGAGCTCTTGGAGTCCAGGCTGAGGGTCTTGAAGAAGGA
ACTGGAGGACTGTGAGGTGTTCCGGTCCACGGAAAAGAAGGAGAGCAAGGAGCTGCTGAAACAGATGGCA
GCGGAGCAGGAGAAGGTGGGGGCAGAGTTCCAGGCACTGAGGGCTTTCCTGGTGGAGCAGGAGGGTCGGC
TGCTAGGCCGCCTGGAGGAACTGTCCCGGGAGGTGGCACAGAAGCAGAATGAGAACCTGGCCCAGCTCGG
GGTTGAGATCACCCAGCTGTCCAAGCTCAGCAGCCAGATCCAGGAGACAGCTCAAAAGCCTGACCTTGAC
TTTCTCCAGGAATTCAAAAGCACGCTGAGCAGGTGTAGCAATGTGCCTGGCCCCAAGCCAACCACAGTCT
CTTCTGAGATGAAGAATAAAGTCTGGAATGTTTCTCTCAAGACCTTTGTCTTAAAAGGGATGCTGAAGAA
GTTCAAAGAGGACCTTCGGGGAGAGCTGGAGAAAGAGGAGAAAGTGGAGCTCACCTTGGATCCCGACACG
GCCAACCCGCGCCTCATCCTCTCTCTGGATCTTAAGGGCGTGCGCCTCGGCGAGCGGGCCCAGGACCTGC
CCAACCACCCCTGCCGCTTCGACACCAACACCCGCGTCCTGGCGTCCTGCGGCTTCTCCTCGGGCCGGCA
TCACTGGGAGGTGGAGGTGGGCTCTAAGGACGGCTGGGCCTTTGGCGTGGCCCGCGAGAGCGTGCGCCGA
AAGGGCCTGACGCCCTTCACTCCCGAGGAGGGCGTCTGGGCCCTGCAGCTCAACGGCGGCCAGTACTGGG
CCGTGACCAGCCCCGAGCGGTCGCCCCTCAGCTGCGGGCACCTGTCGCGCGTGCGGGTGGCCCTGGACCT
GGAGGTGGGAGCCGTGTCCTTCTACGCTGTGGAGGACATGCGCCACCTCTACACCTTCCGCGTCAACTTC
CAGGAGCGCGTGTTCCCGCTTTTCTCTGTTTGCTCCACGGGCACCTACTTGCGAATCTGGCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224754 representing NM_203293
Red=Cloning site Green=Tags(s)

MAAVGPRTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWERPGAGSVGAATR
APPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQAAAARAAAARCGQHGEPFKLY
CQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLESRLRVLKKELEDCEVFRSTEKKESKELLKQMA
AEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLD
FLQEFKSTLSRCSNVPGPKPTTVSSEMKNKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDT
ANPRLILSLDLKGVRLGERAQDLPNHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRR
KGLTPFTPEEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNF
QERVFPLFSVCSTGTYLRIWP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_203293
ORF Size 1533 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_203293.3
RefSeq Size 2862 bp
RefSeq ORF 1536 bp
Locus ID 81786
UniProt ID Q9C029
Cytogenetics 5q35.3
Protein Families Druggable Genome
MW 56.5 kDa
Gene Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1, a B-box type 2, and a coiled-coil region. The protein localizes to both the nucleus and the cytoplasm, and may represent a participant in the initiation of glycogen synthesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.