RNF90 (TRIM7) (NM_033342) Human Tagged ORF Clone

SKU
RC224699
TRIM7 (Myc-DDK-tagged)-Human tripartite motif containing 7 (TRIM7), transcript variant 6
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF90
Synonyms GNIP; RNF90
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224699 representing NM_033342
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTGTGGGACCGCGGACCGGCCCCGGAACCGGCGCCGAGGCTCTAGCGCTGGCGGCAGAGCTGC
AGGGCGAGGCGACGTGCTCCATCTGCCTAGAGCTCTTTCGTGAGCCGGTGTCCGTCGAGTGCGGCCACAG
CTTCTGCCGCGCCTGCATAGGGCGCTGCTGGGAGCGCCCGGGCGCGGGGTCTGTTGGGGCCGCCACCCGC
GCGCCCCCCTTCCCACTGCCCTGTCCGCAGTGCCGCGAGCCCGCGCGCCCCAGTCAGCTGCGGCCCAACC
GGCAGCTGGCGGCAGTGGCCACGCTCCTGCGGCGCTTCAGCCTGCCCGCGGCTGCCCCGGGAGAGCACGG
GTCTCAGGCGGCCGCGGCCCGGGCAGCGGCTGCCCGCTGCGGGCAGCATGGCGAACCCTTCAAGCTCTAC
TGCCAGGACGACGGACGCGCCATCTGCGTGGTGTGCGACCGCGCCCGCGAGCACCGCGAGCACGCCGTGC
TGCCGCTGGACGAGGCGGTGCAGGAGGCCAAGGAGCTCTTGGAGTCCAGGCTGAGGGTCTTGAAGAAGGA
ACTGGAGGACTGTGAGGTGTTCCGGTCCACGGAAAAGAAGGAGAGCAAGGAGCTGCTGGTGAGCCAGGCA
CCCGCAGGCCCCCCGTGGGACATTACAGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224699 representing NM_033342
Red=Cloning site Green=Tags(s)

MAAVGPRTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWERPGAGSVGAATR
APPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQAAAARAAAARCGQHGEPFKLY
CQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLESRLRVLKKELEDCEVFRSTEKKESKELLVSQA
PAGPPWDITEA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033342
ORF Size 663 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033342.4
RefSeq Size 1114 bp
RefSeq ORF 666 bp
Locus ID 81786
UniProt ID Q9C029
Cytogenetics 5q35.3
Domains RING, zf-B_box
Protein Families Druggable Genome
MW 23.5 kDa
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1, a B-box type 2, and a coiled-coil region. The protein localizes to both the nucleus and the cytoplasm, and may represent a participant in the initiation of glycogen synthesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:RNF90 (TRIM7) (NM_033342) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224699L3 Lenti-ORF clone of TRIM7 (Myc-DDK-tagged)-Human tripartite motif containing 7 (TRIM7), transcript variant 6 10 ug
$630.00
RC224699L4 Lenti-ORF clone of TRIM7 (mGFP-tagged)-Human tripartite motif containing 7 (TRIM7), transcript variant 6 10 ug
$630.00
RG224699 TRIM7 (tGFP-tagged) - Human tripartite motif containing 7 (TRIM7), transcript variant 6 10 ug
$489.00 MSRP $530.00 MSRP $530.00
SC111449 TRIM7 (untagged)-Human tripartite motif containing 7 (TRIM7), transcript variant 6 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.