GGA1 (NM_001001561) Human Tagged ORF Clone

SKU
RC224640
GGA1 (Myc-DDK-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GGA1
Synonyms ADP-ribosylation factor binding protein 1; gamma-adaptin related protein 1; golgi associated, gamma adaptin ear containing, ARF binding protein 1; OTTHUMP00000028975; OTTHUMP00000042200
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224640 representing NM_001001561
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCGCGATGGAGCCGGAGACTCTGGAGGCGCGAATCAATAGAGCCACGAACCCCCTGAACAAGG
AGCTCGACTGGGCCAGCATCAACGGCTTCTGCGAGCAGCTCAACGAGGACTTTGAGGGGCCTCCACTCGC
CACCCGGCTGCTGGCCCACAAGATCCAGTCCCCACAGGAGTGGGAGGCGATCCAGGCCTTGACGGTGAGA
AGGGGAGAGGCCACCATCCGTCCCCCGCCATGTGACGACACCAAGGGAGGCCAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224640 representing NM_001001561
Red=Cloning site Green=Tags(s)

MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVR
RGEATIRPPPCDDTKGGQD

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001001561
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001561.2, NP_001001561.1
RefSeq Size 1714 bp
RefSeq ORF 270 bp
Locus ID 26088
Cytogenetics 22q13.1
Protein Families Druggable Genome
Protein Pathways Lysosome
MW 10 kDa
Summary This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GGA1 (NM_001001561) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224640L3 Lenti-ORF clone of GGA1 (Myc-DDK-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 10 ug
$465.00
RC224640L4 Lenti-ORF clone of GGA1 (mGFP-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 10 ug
$465.00
RG224640 GGA1 (tGFP-tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 10 ug
$365.00
SC300218 GGA1 (untagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.