GGA1 (NM_001001561) Human Tagged ORF Clone
SKU
RC224640
GGA1 (Myc-DDK-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | GGA1 |
Synonyms | ADP-ribosylation factor binding protein 1; gamma-adaptin related protein 1; golgi associated, gamma adaptin ear containing, ARF binding protein 1; OTTHUMP00000028975; OTTHUMP00000042200 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC224640 representing NM_001001561
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGCCCGCGATGGAGCCGGAGACTCTGGAGGCGCGAATCAATAGAGCCACGAACCCCCTGAACAAGG AGCTCGACTGGGCCAGCATCAACGGCTTCTGCGAGCAGCTCAACGAGGACTTTGAGGGGCCTCCACTCGC CACCCGGCTGCTGGCCCACAAGATCCAGTCCCCACAGGAGTGGGAGGCGATCCAGGCCTTGACGGTGAGA AGGGGAGAGGCCACCATCCGTCCCCCGCCATGTGACGACACCAAGGGAGGCCAAGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC224640 representing NM_001001561
Red=Cloning site Green=Tags(s) MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVR RGEATIRPPPCDDTKGGQD myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001001561 |
ORF Size | 267 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001001561.2, NP_001001561.1 |
RefSeq Size | 1714 bp |
RefSeq ORF | 270 bp |
Locus ID | 26088 |
Cytogenetics | 22q13.1 |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome |
MW | 10 kDa |
Summary | This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC224640L3 | Lenti-ORF clone of GGA1 (Myc-DDK-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 | 10 ug |
$465.00
|
|
RC224640L4 | Lenti-ORF clone of GGA1 (mGFP-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 | 10 ug |
$465.00
|
|
RG224640 | GGA1 (tGFP-tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 | 10 ug |
$365.00
|
|
SC300218 | GGA1 (untagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 3 | 10 ug |
$165.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.