OR3A2 (NM_002551) Human Tagged ORF Clone

SKU
RC224519
OR3A2 (Myc-DDK-tagged)-Human olfactory receptor, family 3, subfamily A, member 2 (OR3A2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OR3A2
Synonyms OLFRA04; OR17-14; OR17-228; OR228
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224519 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTACAGAAACTCATGGAGCCAGAAGCTGGGACCAATAGGACCGCTGTTGCTGAGTTCATTCTAC
TGGGCCTAGTGCAAACAGAAGAGATGCAGCCAGTTGTCTTTGTGCTCCTCCTCTTTGCCTATCTGGTCAC
AACTGGGGGCAACCTCAGCATCCTGGCAGCCGTCTTGGTGGAGCCCAAACTCCACGCCCCCATGTACTTC
TTCCTGGGGAACCTGTCAGTGCTGGATGTCGGATGTATCACTGTCACTGTTCCTGCAATGTTGGGTCGTC
TCTTGTCCCACAAGTCCACAATTTCCTATGACGCCTGCCTCTCCCAGCTCTTCTTCTTCCACCTTCTGGC
TGGGATGGACTGCTTCCTGCTGACCGCCATGGCCTATGACCGACTCCTGGCCATCTGCCAGCCCCTCACC
TACAGCACCCGCATGAGTCAGACAGTCCAGAGGATGTTGGTGGCTGCGTCCTTGGCTTGTGCCTTCACCA
ACGCACTGACCCACACTGTGGCCATGTCCACGCTCAACTTCTGTGGCCCCAATGAGGTCAATCACTTCTA
CTGTGACCTCCCACAGCTCTTCCAGCTCTCCTGCTCCAGCACCCAACTCAATGAGCTGCTGCTCTTTGCT
GTGGGTTTCATCATGGCAGGCACACCTTTGGTTCTCATCATCACTGCCTACAGCCACGTGGCAGCTGCAG
TTCTACGAATCCGTTCAGTGGAGGGCCGAAAGAAGGCCTTCTCCACGTGTGGCTCCCACCTCACCGTGGT
TTGTCTTTTCTTTGGAAGAGGTATCTTCAACTACATGAGACTGGGTTCAGAGGAGGCTTCAGACAAGGAT
AAAGGGGTTGGAGTTTTCAACACTGTTATCAACCCTATGCTGAACCCTCTTATCTACAGCCTCAGAAACC
CTGATGTTCAGGGTGCTCTGTGGCAAATATTTTTGGGGAGGAGATCACTGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224519 protein sequence
Red=Cloning site Green=Tags(s)

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLVEPKLHAPMYF
FLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTAMAYDRLLAICQPLT
YSTRMSQTVQRMLVAASLACAFTNALTHTVAMSTLNFCGPNEVNHFYCDLPQLFQLSCSSTQLNELLLFA
VGFIMAGTPLVLIITAYSHVAAAVLRIRSVEGRKKAFSTCGSHLTVVCLFFGRGIFNYMRLGSEEASDKD
KGVGVFNTVINPMLNPLIYSLRNPDVQGALWQIFLGRRSLT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002551
ORF Size 963 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002551.3, NP_002542.3
RefSeq Size 1085 bp
RefSeq ORF 948 bp
Locus ID 4995
UniProt ID P47893
Cytogenetics 17p13.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Olfactory transduction
MW 35.2 kDa
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:OR3A2 (NM_002551) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224519L3 Lenti ORF clone of Human olfactory receptor, family 3, subfamily A, member 2 (OR3A2), Myc-DDK-tagged 10 ug
$600.00
RC224519L4 Lenti ORF clone of Human olfactory receptor, family 3, subfamily A, member 2 (OR3A2), mGFP tagged 10 ug
$600.00
RG224519 OR3A2 (tGFP-tagged) - Human olfactory receptor, family 3, subfamily A, member 2 (OR3A2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303218 OR3A2 (untagged)-Human olfactory receptor, family 3, subfamily A, member 2 (OR3A2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.