SSX4 (NM_005636) Human Tagged ORF Clone

SKU
RC224314
SSX4 (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SSX4
Synonyms CT5.4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224314 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGGAGACGACGCCTTTGCAAGGAGACCCAGGGATGATGCTCAAATATCAGAGAAGTTACGAAAGG
CCTTCGATGATATTGCCAAATACTTCTCTAAGAAAGAGTGGGAAAAGATGAAATCCTCGGAGAAAATCGT
CTATGTGTATATGAAGCTAAACTATGAGGTCATGACTAAACTAGGTTTCAAGGTCACCCTCCCACCTTTC
ATGCGTAGTAAACGGGCTGCAGACTTCCACGGGAATGATTTTGGTAACGATCGAAACCACAGGAATCAGG
TTGAACGTCCTCAGATGACTTTCGGCAGCCTCCAGAGAATCTTCCCGAAGATCATGCCCAAGAAGCCAGC
AGAGGAAGAAAATGGTTTGAAGGAAGTGCCAGAGGCATCTGGCCCACAAAATGATGGGAAACAGCTGTGC
CCCCCGGGAAATCCAAGTACCTTGGAGAAGATCAACAAGACATCTGGACCCAAAAGGGGGAAACATGCCT
GGACCCACAGACTGCGTGAGAGAAAGCAGCTGGTGGTTTATGAAGAGATCAGCGACCCTGAGGAAGATGA
CGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224314 protein sequence
Red=Cloning site Green=Tags(s)

MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPF
MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLC
PPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005636
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005636.2
RefSeq Size 1250 bp
RefSeq ORF 567 bp
Locus ID 6759
UniProt ID O60224
Cytogenetics Xp11.23
Protein Families Transcription Factors
MW 21.9 kDa
Summary The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SSX4 (NM_005636) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224314L3 Lenti ORF clone of Human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC224314L4 Lenti ORF clone of Human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1, mGFP tagged 10 ug
$600.00
RG224314 SSX4 (tGFP-tagged) - Human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126384 SSX4 (untagged)-Human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.