Peroxiredoxin 5 (PRDX5) (NM_181651) Human Tagged ORF Clone

SKU
RC224020
PRDX5 (Myc-DDK-tagged)-Human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Peroxiredoxin 5
Synonyms ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX6; prx-V; PRXV; SBBI10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224020 representing NM_181651
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGACTAGCTGGCGTGTGCGCCCTGAGACGCTCAGCGGGCTATATACTCGTCGGTGGGGCCGGCGGTC
AGTCTGCGGCAGCGGCAGCAAGACGGTGCAGTGAAGGAGAGTGGGCGTCTGGCGGGGTCCGCAGTTTCAG
CAGAGCCGCTGCAGCCATGGCCCCAATCAAGGTGGGAGATGCCATCCCAGCAGTGGAGGTGTTTGAAGGG
GAGCCAGGGAACAAGGTGAACCTGGCAGAGCTGTTCAAGGGCAAGAAGGGTGTGCTGTTTGGAGTTCCTG
GGGCCTTCACCCCTGGATGTTCCAAGGTTCGGCTCCTGGCTGATCCCACTGGGGCCTTTGGGAAGGAGAC
AGACTTATTACTAGATGATTCGCTGGTGTCCATCTTTGGGAATCGACGTCTCAAGAGGTTCTCCATGGTG
GTACAGGATGGCATAGTGAAGGCCCTGAATGTGGAACCAGATGGCACAGGCCTCACCTGCAGCCTGGCAC
CCAATATCATCTCACAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224020 representing NM_181651
Red=Cloning site Green=Tags(s)

MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG
EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMV
VQDGIVKALNVEPDGTGLTCSLAPNIISQL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181651
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181651.2, NP_857634.1
RefSeq Size 781 bp
RefSeq ORF 513 bp
Locus ID 25824
UniProt ID P30044
Cytogenetics 11q13.1
Protein Families Druggable Genome
MW 17.4 kDa
Summary This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. [provided by RefSeq, Nov 2017]
Write Your Own Review
You're reviewing:Peroxiredoxin 5 (PRDX5) (NM_181651) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224020L3 Lenti-ORF clone of PRDX5 (Myc-DDK-tagged)-Human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$630.00
RC224020L4 Lenti-ORF clone of PRDX5 (mGFP-tagged)-Human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$630.00
RG224020 PRDX5 (tGFP-tagged) - Human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$489.00 MSRP $530.00 MSRP $530.00
SC110342 PRDX5 (untagged)-Human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.