MAGEA4 (NM_001011550) Human Tagged ORF Clone

SKU
RC223991
MAGEA4 (Myc-DDK-tagged)-Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAGEA4
Synonyms CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223991 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCTGAGCAGAAGAGTCAGCACTGCAAGCCTGAGGAAGGCGTTGAGGCCCAAGAAGAGGCCCTGG
GCCTGGTGGGTGCACAGGCTCCTACTACTGAGGAGCAGGAGGCTGCTGTCTCCTCCTCCTCTCCTCTGGT
CCCTGGCACCCTGGAGGAAGTGCCTGCTGCTGAGTCAGCAGGTCCTCCCCAGAGTCCTCAGGGAGCCTCT
GCCTTACCCACTACCATCAGCTTCACTTGCTGGAGGCAACCCAATGAGGGTTCCAGCAGCCAAGAAGAGG
AGGGGCCAAGCACCTCGCCTGACGCAGAGTCCTTGTTCCGAGAAGCACTCAGTAACAAGGTGGATGAGTT
GGCTCATTTTCTGCTCCGCAAGTATCGAGCCAAGGAGCTGGTCACAAAGGCAGAAATGCTGGAGAGAGTC
ATCAAAAATTACAAGCGCTGCTTTCCTGTGATCTTCGGCAAAGCCTCCGAGTCCCTGAAGATGATCTTTG
GCATTGACGTGAAGGAAGTGGACCCCACCAGCAACACCTACACCCTTGTCACCTGCCTGGGCCTTTCCTA
TGATGGCCTGCTGGGTAATAATCAGATCTTTCCCAAGACAGGCCTTCTGATAATCGTCCTGGGCACAATT
GCAATGGAGGGCGACAGCGCCTCTGAGGAGGAAATCTGGGAGGAGCTGGGTGTGATGGGGGTGTATGATG
GGAGGGAGCACACTGTCTATGGGGAGCCCAGGAAACTGCTCACCCAAGATTGGGTGCAGGAAAACTACCT
GGAGTACCGGCAGGTACCCGGCAGTAATCCTGCGCGCTATGAGTTCCTGTGGGGTCCAAGGGCTCTGGCT
GAAACCAGCTATGTGAAAGTCCTGGAGCATGTGGTCAGGGTCAATGCAAGAGTTCGCATTGCCTACCCAT
CCCTGCGTGAAGCAGCTTTGTTAGAGGAGGAAGAGGGAGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223991 protein sequence
Red=Cloning site Green=Tags(s)

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS
ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV
IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI
AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA
ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001011550
ORF Size 951 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001011550.1, NP_001011550.1
RefSeq Size 1712 bp
RefSeq ORF 954 bp
Locus ID 4103
UniProt ID P43358
Cytogenetics Xq28
MW 34.9 kDa
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Several variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:MAGEA4 (NM_001011550) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223991L1 Lenti ORF clone of Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC223991L2 Lenti ORF clone of Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, mGFP tagged 10 ug
$600.00
RC223991L3 Lenti ORF clone of Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC223991L4 Lenti ORF clone of Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, mGFP tagged 10 ug
$600.00
RG223991 MAGEA4 (tGFP-tagged) - Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC301578 MAGEA4 (untagged)-Human melanoma antigen family A, 4 (MAGEA4), transcript variant 4 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.